MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint christians-2019-1 yeast Saccharomyces cerevisiae Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S., Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S. stefan.pusch@med.uni-heidelberg.de International journal of cancer 2019 Only protein-protein interactions imex curation imex curation christians-2019-2 human-c32 C32 melanoma cell line, amelanotic (colourless) Human c32 C32 melanoma cell line, amelanotic (colourless) https://www.lgcstandards-atcc.org/products/all/CRL-1585 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S., Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S. Nine of 10 potential interactors generated a fluorescent signal in PLA (Suppl. Fig. 1) and 8 of 10 in BiFC (Suppl. Fig. 2). The most pronounced signal in both assays was generated with FLOT1, HTATIP2, RAP2A and PLP2 (Fig. 4, summary of interactions shown in Suppl. Fig. 1 and 2). The fluorescent signal was detectable in different compartments of the cell, mainly in the cytoplasmic and membrane compartments. RAB10-EMP3 association was only detected with PLA (Suppl. Fig. 1). stefan.pusch@med.uni-heidelberg.de International journal of cancer 2019 Only protein-protein interactions imex curation imex curation christians-2019-3 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S., Christians A., Poisel E., Hartmann C., von Deimling A., Pusch S. Nine of 10 potential interactors generated a fluorescent signal in PLA (Suppl. Fig. 1) and 8 of 10 in BiFC (Suppl. Fig. 2). The most pronounced signal in both assays was generated with FLOT1, HTATIP2, RAP2A and PLP2 (Fig. 4, summary of interactions shown in Suppl. Fig. 1 and 2). The fluorescent signal was detectable in different compartments of the cell, mainly in the cytoplasmic and membrane compartments. RAB10-EMP3 association was only detected with PLA (Suppl. Fig. 1). stefan.pusch@med.uni-heidelberg.de International journal of cancer 2019 Only protein-protein interactions imex curation imex curation flot1_human Flotillin-1 FLOT1 protein protein human Homo sapiens Human MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVNHKPLRTA emp3_human Epithelial membrane protein 3 EMP3 YMP Hematopoietic neural membrane protein 1 Protein YMP protein protein human Homo sapiens Human MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE htai2_human Oxidoreductase HTATIP2 HTATIP2 30 kDa HIV-1 TAT-interacting protein CC3 HIV-1 TAT-interactive protein 2 TIP30 protein protein human Homo sapiens Human MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP ppla_human Cardiac phospholamban PLN PLB protein protein human Homo sapiens Human MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL plp2_human Proteolipid protein 2 Intestinal membrane A4 protein Differentiation-dependent protein A4 PLP2 A4 protein protein human Homo sapiens Human MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV cklf5_human CKLF-like MARVEL transmembrane domain-containing protein 5 CMTM5 CKLFSF5 Chemokine-like factor superfamily member 5 protein protein human Homo sapiens Human MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLLQGHGQSGGPHPLDLLSHSAKVQPQPWPGLTPPGWHTPAAVPWVPAPAPGFWSWLLWFICFHSLGSSDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ vamp3_human Vesicle-associated membrane protein 3 Synaptobrevin-3 Cellubrevin VAMP3 SYB3 protein protein human Homo sapiens Human MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS tmm51_human Transmembrane protein 51 TMEM51 C1orf72 protein protein human Homo sapiens Human MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLVGAGVMLLLLSICLSIRDKRKQRQGEDLAHVQHPTGAGPHAQEEDSQEEEEEDEEAASRYYVPSYEEVMNTNYSEARGEEQNPRLSISLPSYESLTGLDETTPTSTRADVEASPGNPPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFRINLPDKNVPPPSIEPLTPPPQYDEVQEKAPDTRPPD bsdc1_human BSD domain-containing protein 1 BSDC1 UNQ2494/PRO5781 protein protein human Homo sapiens Human MAEGEDVGWWRSWLQQSYQAVKEKSSEALEFMKRDLTEFTQVVQHDTACTIAATASVVKEKLATEGSSGATEKMKKGLSDFLGVISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYCNEPDGPPELFDAWLSQFCLEEKKGEISELLVGSPSIRALYTKMVPAAVSHSEFWHRYFYKVHQLEQEQARRDALKQRAEQSISEEPGWEEEEEELMGISPISPKEAKVPVAKISTFPEGEPGPQSPCEENLVTSVEPPAEVTPSESSESISLVTQIANPATAPEARVLPKDLSQKLLEASLEEQGLAVDVGETGPSPPIHSKPLTPAGHTGGPEPRPPARVETLREEAPTDLRVFELNSDSGKSTPSNNGKKGSSTDISEDWEKDFDLDMTEEEVQMALSKVDASGELEDVEWEDWE rap2a_human Ras-related protein Rap-2a RbBP-30 RAP2A protein protein human Homo sapiens Human MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ rab10_human Ras-related protein Rab-10 RAB10 protein protein human Homo sapiens Human MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC emp3-flot1-1 3539957 N/A 3539960 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3539961 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false table 1 emp3-htatip2-1 3539957 N/A 3539962 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3539961 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false table 1 emp3-pln-1 3539957 N/A 3539963 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3539961 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false table 1 emp3-plp2-1 3539957 N/A 3539964 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3539961 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false table 1 emp3-cmtm5-1 3539957 N/A 3539965 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3539961 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false table 1 emp3-vamp3-1 3539957 N/A 3539966 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3539961 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false table 1 emp3-tmem51-1 3539957 N/A 3539967 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3539961 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false table 1 emp3-bsdc1-1 3539957 N/A 3539968 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3539961 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false table 1 emp3-rap2a-1 3539957 N/A 3539969 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3539961 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false table 1 emp3-rab10-1 3539957 N/A 3539970 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell N/A 3539961 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false table 1 bsdc1-emp3-1 3539958 N/A 3539968 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction false false false suppl fig 1 emp3-rab10-2 3539958 N/A 3539970 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction false false false suppl fig 1 emp3-htatip2-2 3539958 N/A 3539962 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction false false false fig 4a suppl fig 1 emp3-plp2-2 3539958 N/A 3539964 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction false false false fig 4a; suppl fig 1 emp3-flot1-2 3539958 N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539960 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction false false false fig 4a, suppl fig 1 emp3-rap2a-2 3539958 N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539969 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction false false false fig 4a, suppl fig 1 cmtm5-emp3-1 3539958 N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539965 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction false false false suppl fig 1 emp3-vamp3-2 3539958 N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539966 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction false false false suppl fig 1 emp3-tmem51-2 3539958 N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539967 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction false false false suppl fig 1 emp3-htatip2-3 3539959 N/A 3539962 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association false false false fig 4a suppl fig 2 emp3-plp2-3 3539959 N/A 3539964 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association false false false fig 4b; suppl fig 2 emp3-flot1-3 3539959 N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539960 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association false false false fig 4a, suppl fig 2 emp3-rap2a-3 3539959 N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539969 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association false false false fig 4a, suppl fig 2 emp3-tmem51-3 3539959 N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539967 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association false false false suppl fig 1 emp3-vamp3-3 3539959 N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539966 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association false false false suppl fig 2 bsdc1-emp3-2 3539959 N/A 3539968 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association false false false suppl fig 1 cmtm5-emp3-2 3539959 N/A 3539961 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell N/A 3539965 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell physical association physical association false false false suppl fig 2