UniProt UniProt http://www.uniprot.org shin-2018-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Shin S., Lim S., Jeong H., Kwan LT., Kim YK. yunkyungkim@kist.re.kr International journal of molecular sciences 2018 Only protein-protein interactions imex curation imex curation shin-2018-3 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Shin S., Lim S., Jeong H., Kwan LT., Kim YK. The BODIPY-fluorescence sensor (BD-tau) selectively responds to pathological tau aggregates yunkyungkim@kist.re.kr International journal of molecular sciences 2018 Only protein-protein interactions imex curation imex curation tba1a_human Tubulin alpha-1A chain TUBA1A Tubulin B-alpha-1 Tubulin alpha-3 chain Alpha-tubulin 3 TUBA3 protein protein human Homo sapiens Human MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY tbb5_human Tubulin beta chain TUBB Tubulin beta-5 chain TUBB5 OK/SW-cl.56 protein protein human Homo sapiens Human MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA p10636-8 Microtubule-associated protein tau Tau-4 MAPT MAPTL MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau 2N4R protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL tau_human Microtubule-associated protein tau MAPT MTBT1 TAU Neurofibrillary tangle protein Paired helical filament-tau MAPTL protein protein human Homo sapiens Human MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREPGPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEGPPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEADLPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL tuba1a-tuba1a-1 3555367 N/A 3555369 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3555369 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 1C(i), 1E(i), Supp. Fig. 1D tuba1a-tuba1a-2 3555367 N/A 3555370 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3555370 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 1C(ii) tuba1a-tubb-1 3555367 N/A 3555369 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3555370 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 1C(iii), 1E(iii), Supp. Fig. 1D tuba1a-tubb-2 3555367 N/A 3555369 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3555370 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-c venus c-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 1C(v), 1E(v) tuba1a-tubb-3 3555367 N/A 3555369 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-c venus c-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3555370 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 1C(vi) mapt-tubb-1 3555367 N/A 3555371 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-c venus c-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3555370 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A(iii) mapt-tuba1a-1 3555367 N/A 3555371 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-c venus c-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3555369 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figs. 2A(v), 2F, 3B, 3D, 3F, 4A-C, Supp. Figs. 1D, 3 Taxol Vinblastine Nocodazole Forskolin Thapsigargin mapt-tuba1a-2 3555367 N/A 3555371 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-n venus n-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3555369 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A(vi) mapt-mapt-3 3555367 N/A 3555371 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-c venus c-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3555371 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-n venus n-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 4A, 4B, Supp. Fig. 3 Thapsigargin Forskolin tuba1a-tubb-4 3555367 N/A 3555369 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-n venus n-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3555370 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-c venus c-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 1D mapt-tuba1a-3 3555368 N/A 3555372 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region bodipy label bodipy label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3555369 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminal venus-n venus n-terminal fragment n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3555371 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed c-terminal venus-c venus c-terminal fragment c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Supp. Fig. 5 Prion-like tau seed (tauK18P301L) Thapsigargin (CHEBI:9516) Forskolin (CHEBI:42471)