UniProt UniProt http://www.uniprot.org le-2018-1 spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down anti tag western anti tag western blot anti tag western Le LTM., Nyengaard JR., Golas MM., Sander B. Data relating to IgG2A could not be captured as this is a purified complex and will consist of a mixture of different heavy and light chains. bsander@clin.au.dk Molecular biotechnology 2018 Only protein-protein interactions imex curation imex curation le-2018-2 spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Le LTM., Nyengaard JR., Golas MM., Sander B. Data relating to IgG2A could not be captured as this is a purified complex and will consist of a mixture of different heavy and light chains. bsander@clin.au.dk Molecular biotechnology 2018 Only protein-protein interactions imex curation imex curation fcerg_human High affinity immunoglobulin epsilon receptor subunit gamma IgE Fc receptor subunit gamma Fc-epsilon RI-gamma FCER1G Fc receptor gamma-chain protein protein human Homo sapiens Human MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ fcgr1_human High affinity immunoglobulin gamma Fc receptor I FCGR1A FCG1 FCGR1 IGFR1 Fc-gamma RI Fc-gamma RIA protein protein human Homo sapiens Human MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRNTSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT fcer1g-fcgr1a-1 3533295 N/A 3533297 unspecified role unspecified role prey prey partially purified partially purified N/A 3533298 unspecified role unspecified role bait bait partially purified partially purified c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P12314:p.[Thr20Pro;Thr38Ser;Leu46Pro;Thr63Ile;Ser69Thr;Asn78Asp;Ile100Val;Phe114Leu;Ile160Met;Asn163Ser;Asn195Thr;Leu207Pro;Asn240Asp] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Fig. 3B fcgr1a-fcer1g-1 3533296 N/A 3533297 unspecified role unspecified role neutral component neutral component partially purified partially purified N/A 3533298 unspecified role unspecified role neutral component neutral component partially purified partially purified c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false P12314:p.[Thr20Pro;Thr38Ser;Leu46Pro;Thr63Ile;Ser69Thr;Asn78Asp;Ile100Val;Phe114Leu;Ile160Met;Asn163Ser;Asn195Thr;Leu207Pro;Asn240Asp] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Fig. 4