UniProt UniProt http://www.uniprot.org zhou-2017-4 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou X., Paushter DH., Feng T., Pardon CM., Mendoza CS., Hu F. fh87@cornell.edu Acta neuropathologica 2017 Only protein-protein interactions imex curation imex curation zhou-2017-5 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou X., Paushter DH., Feng T., Pardon CM., Mendoza CS., Hu F. Conditioned medium from an unspecified cell line was used as the source of protein in all cases. fh87@cornell.edu Acta neuropathologica 2017 Only protein-protein interactions imex curation imex curation zhou-2017-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhou X., Paushter DH., Feng T., Pardon CM., Mendoza CS., Hu F. fh87@cornell.edu Acta neuropathologica 2017 Only protein-protein interactions imex curation imex curation zhou-2017-3 mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhou X., Paushter DH., Feng T., Pardon CM., Mendoza CS., Hu F. fh87@cornell.edu Acta neuropathologica 2017 Only protein-protein interactions imex curation imex curation catd_human Cathepsin D CTSD CPSD protein protein human Homo sapiens Human MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL grn_human Progranulin Proepithelin GRN Acrogranin Epithelin precursor Glycoprotein of 88 Kda Granulin precursor PC cell-derived growth factor protein protein human Homo sapiens Human MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL p28799-pro_0000012695 Granulin-1 GRN Acrogranin Epithelin precursor Glycoprotein of 88 Kda Granulin precursor PC cell-derived growth factor Proepithelin protein protein human Homo sapiens Human GGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCF 58 113 p28799-pro_0000012696 Granulin-2 GRN Acrogranin Epithelin precursor Glycoprotein of 88 Kda Granulin precursor PC cell-derived growth factor Proepithelin protein protein human Homo sapiens Human AIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCI 123 179 p28799-pro_0000012697 Granulin-3 GRN Acrogranin Epithelin precursor Glycoprotein of 88 Kda Granulin precursor PC cell-derived growth factor Proepithelin protein protein human Homo sapiens Human VMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCL 206 261 p28799-pro_0000012698 Granulin-4 GRN Acrogranin Epithelin precursor Glycoprotein of 88 Kda Granulin precursor PC cell-derived growth factor Proepithelin protein protein human Homo sapiens Human DVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCE 281 336 p28799-pro_0000012699 Granulin-5 GRN Acrogranin Epithelin precursor Glycoprotein of 88 Kda Granulin precursor PC cell-derived growth factor Proepithelin protein protein human Homo sapiens Human VPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQ 364 417 p28799-pro_0000012700 Granulin-6 GRN Acrogranin Epithelin precursor Glycoprotein of 88 Kda Granulin precursor PC cell-derived growth factor Proepithelin protein protein human Homo sapiens Human IGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCE 442 496 p28799-pro_0000012701 Granulin-7 GRN Acrogranin Epithelin precursor Glycoprotein of 88 Kda Granulin precursor PC cell-derived growth factor Proepithelin protein protein human Homo sapiens Human DVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCL 518 573 grn-ctsd-1 3564477 N/A 3564481 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3564482 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2A grn-ctsd-2 3564477 N/A 3564481 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnA 3564483 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2A grn-ctsd-3 3564477 N/A 3564481 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnB 3564484 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2A grn-ctsd-4 3564477 N/A 3564481 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnC 3564485 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2A grn-ctsd-5 3564477 N/A 3564481 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnD 3564486 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2A grn-ctsd-6 3564477 N/A 3564481 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnE 3564487 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2A grn-ctsd-7 3564477 N/A 3564481 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnF 3564488 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2A grn-ctsd-8 3564477 N/A 3564481 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnG 3564489 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2A grn-ctsd-9 3564478 N/A 3564481 unspecified role unspecified role prey prey conditioned medium conditioned medium n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnC 3564485 unspecified role unspecified role bait bait conditioned medium conditioned medium n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2B grn-ctsd-10 3564478 N/A 3564481 unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3564482 unspecified role unspecified role bait bait conditioned medium conditioned medium n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2B grn-ctsd-11 3564478 N/A 3564481 unspecified role unspecified role prey prey conditioned medium conditioned medium n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnA 3564483 unspecified role unspecified role bait bait conditioned medium conditioned medium n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2B grn-ctsd-12 3564478 N/A 3564481 unspecified role unspecified role prey prey conditioned medium conditioned medium n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnB 3564484 unspecified role unspecified role bait bait conditioned medium conditioned medium n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2B grn-ctsd-13 3564478 N/A 3564481 unspecified role unspecified role prey prey conditioned medium conditioned medium n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnD 3564486 unspecified role unspecified role bait bait conditioned medium conditioned medium n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2B grn-ctsd-14 3564478 N/A 3564481 unspecified role unspecified role prey prey conditioned medium conditioned medium n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnE 3564487 unspecified role unspecified role bait bait conditioned medium conditioned medium n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2B grn-ctsd-15 3564478 N/A 3564481 unspecified role unspecified role prey prey conditioned medium conditioned medium n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnF 3564488 unspecified role unspecified role bait bait conditioned medium conditioned medium n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2B grn-ctsd-16 3564478 N/A 3564481 unspecified role unspecified role prey prey conditioned medium conditioned medium n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A GrnG 3564489 unspecified role unspecified role bait bait conditioned medium conditioned medium n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Supp Fig. 2B ctsd-grn-1 3564479 N/A 3564481 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3564482 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Fig. 1A ctsd-grn-2 3564480 N/A 3564481 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3564482 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Fig. 1B Interaction observed in PSAP-/- cells