UniProt UniProt http://www.uniprot.org letronne-2016-1 in vitro In vitro cleavage cleavage assay cleavage tag fluorescence tag visualisation by fluorescence tag fluorescence Letronne F., Laumet G., Ayral AM., Chapuis J., Demiautte F., Laga M., Vandenberghe ME., Malmanche N., Leroux F., Eysert F., Sottejeau Y., Chami L., Flaig A., Bauer C., Dourlen P., Lesaffre M., Delay C., Huot L., Dumont J., Werkmeister E., Lafont F., Mendes T., Hansmannel F., Dermaut B., Deprez B., Hérard AS., Dhenain M., Souedet N., Pasquier F., Tulasne D., Berr C., Hauw JJ., Lemoine Y., Amouyel P., Mann D., Déprez R., Checler F., Hot D., Delzescaux T., Gevaert K., Lambert JC. jean-charles.lambert@pasteur-lille.fr EBioMedicine 2016 Only protein-protein interactions imex curation imex curation letronne-2016-2 human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Letronne F., Laumet G., Ayral AM., Chapuis J., Demiautte F., Laga M., Vandenberghe ME., Malmanche N., Leroux F., Eysert F., Sottejeau Y., Chami L., Flaig A., Bauer C., Dourlen P., Lesaffre M., Delay C., Huot L., Dumont J., Werkmeister E., Lafont F., Mendes T., Hansmannel F., Dermaut B., Deprez B., Hérard AS., Dhenain M., Souedet N., Pasquier F., Tulasne D., Berr C., Hauw JJ., Lemoine Y., Amouyel P., Mann D., Déprez R., Checler F., Hot D., Delzescaux T., Gevaert K., Lambert JC. jean-charles.lambert@pasteur-lille.fr EBioMedicine 2016 Only protein-protein interactions imex curation imex curation letronne-2016-3 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Letronne F., Laumet G., Ayral AM., Chapuis J., Demiautte F., Laga M., Vandenberghe ME., Malmanche N., Leroux F., Eysert F., Sottejeau Y., Chami L., Flaig A., Bauer C., Dourlen P., Lesaffre M., Delay C., Huot L., Dumont J., Werkmeister E., Lafont F., Mendes T., Hansmannel F., Dermaut B., Deprez B., Hérard AS., Dhenain M., Souedet N., Pasquier F., Tulasne D., Berr C., Hauw JJ., Lemoine Y., Amouyel P., Mann D., Déprez R., Checler F., Hot D., Delzescaux T., Gevaert K., Lambert JC. jean-charles.lambert@pasteur-lille.fr EBioMedicine 2016 Only protein-protein interactions imex curation imex curation catd_human Cathepsin D CTSD CPSD protein protein human Homo sapiens Human MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL mca-pro-leu-gly-leu-dpa-ala-arg-nh2 (7-Methoxycoumarin-4-yl)acetyl-Pro-Leu-Gly-Leu-N-3-(2, 4-Dinitrophenyl)-L-2,3-diaminopropionyl-Ala-Arg-NH2 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ada30_human Disintegrin and metalloproteinase domain-containing protein 30 ADAM30 UNQ2509/PRO5997 protein protein human Homo sapiens Human MRSVQIFLSQCRLLLLLVPTMLLKSLGEDVIFHPEGEFDSYEVTIPEKLSFRGEVQGVVSPVSYLLQLKGKKHVLHLWPKRLLLPRHLRVFSFTEHGELLEDHPYIPKDCNYMGSVKESLDSKATISTCMGGLRGVFNIDAKHYQIEPLKASPSFEHVVYLLKKEQFGNQVCGLSDDEIEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIHDAILLTGIMDTYFQDVRMRIHLKALEVWTDFNKIRVGYPELAEVLGRFVIYKKSVLNARLSSDWAHLYLQRKYNDALAWSFGKVCSLEYAGSVSTLLDTNILAPATWSAHELGHAVGMSHDEQYCQCRGRLNCIMGSGRTGFSNCSYISFFKHISSGATCLNNIPGLGYVLKRCGNKIVEDNEECDCGSTEECQKDRCCQSNCKLQPGANCSIGLCCHDCRFRPSGYVCRQEGNECDLAEYCDGNSSSCPNDVYKQDGTPCKYEGRCFRKGCRSRYMQCQSIFGPDAMEAPSECYDAVNLIGDQFGNCEITGIRNFKKCESANSICGRLQCINVETIPDLPEHTTIISTHLQAENLMCWGTGYHLSMKPMGIPDLGMINDGTSCGEGRVCFKKNCVNSSVLQFDCLPEKCNTRGVCNNRKNCHCMYGWAPPFCEEVGYGGSIDSGPPGLLRGAIPSSIWVVSIIMFRLILLILSVVFVFFRQVIGNHLKPKQEKMPLSKAKTEQEESKTKTVQEESKTKTGQEESEAKTGQEESKAKTGQEESKANIESKRPKAKSVKKQKK ctsd-mca_pro_leu_gly_leu_dpa_ala_arg_nh2-1 3564441 N/A 3564444 enzyme enzyme unspecified role unspecified role purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. N/A 3564445 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) protein cleavage protein cleavage false false false Fig. 3B adam30-ctsd-1 3564441 N/A 3564446 enzyme regulator enzyme regulator ancillary ancillary purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q9UKF2:p.[His338Leu;His342Leu;His348Leu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3564444 enzyme enzyme unspecified role unspecified role purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-myeloma Mus musculus myeloma cell line myeloma lymphoblast plasma cell line. N/A 3564445 enzyme target enzyme target substrate substrate unspecified role unspecified role chemical synthesis Chemical synthesis (Chemical synthesis) protein cleavage protein cleavage false false false Fig. 3B adam30-ctsd-2 3564442 N/A 3564444 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3564446 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 3C adam30-ctsd-3 3564443 N/A 3564444 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3564446 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 3C