IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tripathi-2015-3 human-smooth muscle Homo sapiens smooth_muscle smooth muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M., Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M. Results from Supplementary Figure 2 have not been annotated as the species of origin of constructs used is not stated and the authors did not reply to a request for information. human hVSMCs:- primary (aortic) vascular smooth muscle cells mmajetschak@luc.edu Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation tripathi-2015-1 rat-a7r5 Rattus norvegicus a7r5 a7r5 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M., Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M. Results from Supplementary Figure 2 have not been annotated as the species of origin of constructs used is not stated and the authors did not reply to a request for information. mmajetschak@luc.edu Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation tripathi-2015-2 rat-smooth-muscle rat smooth muscle smooth_muscle smooth muscle pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M., Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M. Results from Supplementary Figure 2 have not been annotated as the species of origin of constructs used is not stated and the authors did not reply to a request for information. Rat VSMCs:- primary (aortic and mesenteric artery) vascular smooth muscle cells mmajetschak@luc.edu Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation tripathi-2015-4 human-smooth muscle Homo sapiens smooth_muscle smooth muscle anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M., Tripathi A., Vana PG., Chavan TS., Brueggemann LI., Byron KL., Tarasova NI., Volkman BF., Gaponenko V., Majetschak M. Results from Supplementary Figure 2 have not been annotated as the species of origin of constructs used is not stated and the authors did not reply to a request for information. human hVSMCs:- primary (aortic) vascular smooth muscle cells mmajetschak@luc.edu Proceedings of the National Academy of Sciences of the United States of America 2015 Only protein-protein interactions imex curation imex curation ada1a_human Alpha-1A adrenergic receptor Alpha-1A adrenoreceptor Alpha-1C adrenergic receptor Alpha-adrenergic receptor 1c ADRA1A ADRA1C protein protein human Homo sapiens Human MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCTTARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV cxcr4_human C-X-C chemokine receptor type 4 Stromal cell-derived factor 1 receptor Fusin Leukocyte-derived seven transmembrane domain receptor LCR1 FB22 NPYRL HM89 CXCR4 Lipopolysaccharide-associated protein 3 protein protein human Homo sapiens Human MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS ada1b_human Alpha-1B adrenergic receptor Alpha-1B adrenoreceptor ADRA1B protein protein human Homo sapiens Human MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLTEPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF x4-2–6 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) FVITLPFWAVDAVANWYFGNDD ackr3_human Atypical chemokine receptor 3 ACKR3 C-X-C chemokine receptor type 7 CMKOR1 CXCR7 Chemokine orphan receptor 1 G-protein coupled receptor 159 G-protein coupled receptor RDC1 homolog GPR159 RDC1 protein protein human Homo sapiens Human MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK ada1a_rat Alpha-1A adrenergic receptor Adra1a Adra1c Alpha-1A adrenoreceptor Alpha-1C adrenergic receptor protein protein rat Rattus norvegicus (Rat) Rat MVLLSENASEGSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWVLSLVISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYVPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKNVPAEGGGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTLHPPSQALEGQHRDMVRIPVGSGETFYKISKTDGVCEWKFFSSMPQGSARITVPKDQSACTTARVRSKSFLQVCCCVGSSAPRPEENHQVPTIKIHTISLGENGEEV cxcr4_rat C-X-C chemokine receptor type 4 Cxcr4 Cmkar4 Fusin Leukocyte-derived seven transmembrane domain receptor Stromal cell-derived factor 1 receptor protein protein rat Rattus norvegicus (Rat) Rat MEIYTSDNYSEEVGSGDYDSNKEPCFRDENENFNRIFLPTIYFIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAMADWYFGKFLCKAVHIIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKAVYVGVWIPALLLTIPDIIFADVSQGDGRYICDRLYPDSLWMVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPYYVGISIDSFILLEVIKQGCEFESVVHKWISITEALAFFHCCLNPILYAFLGAKFKSSAQHALNSMSRGSSLKILSKGKRGGHSSVSTESESSSFHSS ackr3_rat Atypical chemokine receptor 3 Ackr3 Cmkor1 Cxcr7 Rdc1 C-X-C chemokine receptor type 7 Chemokine orphan receptor 1 G-protein coupled receptor RDC1 homolog protein protein rat Rattus norvegicus (Rat) Rat MDVHLFDYVEPGNYSDINWPCNSSDCIVVDTVQCPAMPNKNVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVITIPVWVVSLVQHNQWPMGELTCKITHLIFSINLFGSIFFLACMSVDRYLSITYFTSTSSYKKKMVRRVVCVLVWLLAFFVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVILGFAVPFTIIAIFYFLLARAMSASGDQEKHSSRKIIFSYVVVFLVCWLPYHFVVLLDIFSILHYIPFTCQLENVLFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQNTK adra1a-cxcr4-6 3554792 N/A 3554796 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554797 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 1B,2B/D/E, 5D and Supplementary Figure 1. CXCR4 siRNA silencing reduced the PLA signals adra1a-cxcr4-7 3554792 N/A 3554798 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554797 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 2B/D/E, 5E and Supplementary Figure 1. CXCR4 siRNA silencing reduced the PLA signals adra1a-cxcr4-8 3554792 N/A 3554799 competitor competitor competitor neutral component neutral component purified purified C-terminal PEG_tag(CH2CH2O) 27) -NH 2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3554796 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554797 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 3 A/B X4-2–6 (a peptide Derived from Transmembrane Domain 2 of CXCR4) reduced the association between a1A-AR and CXCR4 and between a1B-AR and CXCR4. adra1a-cxcr4-9 3554792 N/A 3554799 competitor competitor competitor neutral component neutral component purified purified C-terminal PEG_tag(CH2CH2O) 27) -NH2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3554798 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554797 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 3 A/B-2 X4-2–6 (a peptide Derived from Transmembrane Domain 2 of CXCR4) reduced the association between a1A-AR and CXCR4 and between a1B-AR and CXCR4. adra1a-cxcr4-10 3554792 N/A 3554800 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554797 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 1B,3A/B, 5F PLA signals corresponding to CXCR4:ACKR3, however, were not affected by X4-2–6. CXCR4 siRNA silencing reduced the PLA signals adra1a-cxcr4-4 3554793 N/A 3554801 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554802 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 1B adra1a-cxcr4-11 3554793 N/A 3554799 competitor competitor competitor neutral component neutral component purified purified C-terminal PEG_tag(CH2CH2O) 27) -NH2 tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3554802 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554801 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false SupplementaryFigure 3 ackr3-cxcr4-17 3554793 N/A 3554803 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554802 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 1B, Supplementary figure 3 This is stated to be a positive control. adra1a-cxcr4-5 3554794 N/A 3554801 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554802 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 1B adra1a-cxcr4-15 3554794 N/A 3554803 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554802 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 1B,Supplementary figure 3 This is stated to be a positive control. ipokaslm-1 3554795 N/A 3554798 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554797 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3554796 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Figure 2F