IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ santos-2012-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt human brain cDNA library PloS one 2012 Only protein-protein interactions imex curation imex curation santos-2012-7 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt PloS one 2012 Only protein-protein interactions imex curation imex curation santos-2012-8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt human brain cDNA library PloS one 2012 Only protein-protein interactions imex curation imex curation santos-2012-12 rat-brain-cortex Rattus norvegicus brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt PloS one 2012 Only protein-protein interactions imex curation imex curation santos-2012-9 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt PloS one 2012 Only protein-protein interactions imex curation imex curation santos-2012-10 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt PloS one 2012 Only protein-protein interactions imex curation imex curation santos-2012-11 human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt PloS one 2012 Only protein-protein interactions imex curation imex curation santos-2012-13 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Santos M., Rebelo S., Van Kleeff PJ., Kim CE., Dauer WT., Fardilha M., da Cruz E Silva OA., da Cruz E Silva EF. From PMID; 15659832 (ref. 35) Nek2a is of human origin and expressed in bacteria. From PMID: 22321011 (ref. 19) PP1alpha is of human origin. From PMID: 21382349 (same authors) PP1gamma1 and PP1gamma2 are of human origin, PP1gamma2END lacks the last 39aa. From PMID: 14674258 (ref. 28) recombinant PP1gamma1 is human and expressed in sf9 cells. According to IMEx rules COIP performed using aspecific antibodies (e.g. Fig. 7) were not captured. srebelo@ua.pt PloS one 2012 Only protein-protein interactions imex curation imex curation pp1a_human Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA PPP1A protein protein human Homo sapiens Human MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK q5jtv8-3 Torsin-1A-interacting protein 1 Lamin-associated protein 1B TOR1AIP1 LAP1 protein protein human Homo sapiens Human MAGDGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTPPSRQGRREVRFSDEPPEVYGDFEPLVAKERSPVGKRTRLEEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPLQPSPVMTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSIQEAPAVSEDLVIRLRRPPLRYPRYEATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQPSVLSSGYQKTPQEWAPQTARIRTRMQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWWLLPLIAALASGSFWFFSTPEVETTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAIRIDGTDKATQDSDTVKLEVDQELSNGFKNGQNAAVVHRFESFPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGLWSRISHLVLPVQPENALKRGICL No experimental confirmation available. p36873-1 Serine/threonine-protein phosphatase PP1-gamma catalytic subunit PPP1CC Protein phosphatase 1C catalytic subunit Gamma-1 PPPCC1 protein protein human Homo sapiens Human MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK p36873-2 Serine/threonine-protein phosphatase PP1-gamma catalytic subunit Protein phosphatase 1C catalytic subunit PPP1CC Gamma-2 PPPCC2 protein protein human Homo sapiens Human MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRVASGLNPSIQKASNYRNNTVLYE p53_mouse Cellular tumor antigen p53 Tp53 P53 Trp53 Tumor suppressor p53 protein protein mouse Mus musculus Mouse MTAMEESQSDISLELPLSQETFSGLWKLLPPEDILPSPHCMDDLLLPQDVEEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWVSATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD lt_sv40 Large T antigen protein protein sv40 sv40 SV40 MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEIPTYGTDEWEQWWNAFNEENLFCSEEMPSSDDEATADSQHSTPPKKKRKVEDPKDFPSELLSFLSHAVFSNRTLACFAIYTTKEKAALLYKKIMEKYSVTFISRHNSYNHNILFFLTPHRHRVSAINNYAQKLCTFSFLICKGVNKEYLMYSALTRDPFSVIEESLPGGLKEHDFNPEEAEETKQVSWKLVTEYAMETKCDDVLLLLGMYLEFQYSFEMCLKCIKKEQPSHYKYHEKHYANAAIFADSKNQKTICQQAVDTVLAKKRVDSLQLTREQMLTNRFNDLLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSRIVEWKERLDKEFSLSVYQKMKFNVAMGIGVLDWLRNSDDDDEDSQENADKNEDGGEKNMEDSGHETGIDSQSQGSFQAPQSSQSVHDHNQPYHICRGFTCFKKPPTPPPEPET nek2_human Serine/threonine-protein kinase Nek2 NEK2A NimA-like protein kinase 1 HSPK 21 NEK2 NLK1 Never in mitosis A-related kinase 2 protein protein human Homo sapiens Human MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR q5jtv8-1 Torsin-1A-interacting protein 1 Lamin-associated protein 1B TOR1AIP1 LAP1 protein protein human Homo sapiens Human MAGDGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTPPSRQGRREVRFSDEPPEVYGDFEPLVAKERSPVGKRTRLEEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPLQPSPVMTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSIQEAPVSEDLVIRLRRPPLRYPRYEATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQPSVLSSGYQKTPQEWAPQTARIRTRMQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWWLLPLIAALASGSFWFFSTPEVETTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAIRIDGTDKATQDSDTVKLEVDQELSNGFKNGQNAAVVHRFESFPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGLWSRISHLVLPVQPENALKRGICL toip1_rat Torsin-1A-interacting protein 1 Tor1aip1 Lamina-associated polypeptide 1B Lamina-associated polypeptide 1C protein protein rat Rattus norvegicus (Rat) Rat MAGERWRAEGLGEGWAIYVTPRAPIREGRRRLATQNGDGSDAPAYETHPSRHGRREVRFSEEPPEVYGDFEPRAAKERSPGERRTPPEKFRSDSAKEEVRESAYNLRSRQRRQRGPQEAEEMKTRRSTRLEQHSQQAQQQLSPATSGRGLRDAQSLSEDRGEDEPSSQPVTSQTVSKKTVRTPETSVMSEDPISNLCRPPLRSPRPDASIVQHINPFEEGETEDDLESSYSDVTIRIRSRDSVESRDEAAVAAGHHPDSLWGLPHSRGDFTAHENQPSLLPTGCQKNPQEWVEQAVRMRTRMAYNNIQKSDFGNQSPSTSRQQAAVQPPDESSVKIKWWLLILVAALAMGIYWFFHTPVVETTAVQEFQNQMKQLQSKYQSQDEKLWKRGTTFLEKHLNSSLPRPQPAILLLTAAQDAAEVLKCLSEQIADAYSSFRSVRAIRIDGAGKAAQDSDLVKHEVDQELTDGFRNGQNAAVVHRFESLPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEQTLEASLGLKEIEEKVRDFLKVKFTSSDTANSYNHMDPDKLNGLWSRISHLVLPVQPENALKAGSCL pp1g_rat Serine/threonine-protein phosphatase PP1-gamma catalytic subunit Ppp1cc Protein phosphatase 1C catalytic subunit protein protein rat Rattus norvegicus (Rat) Rat MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK pp1a_rat Serine/threonine-protein phosphatase PP1-alpha catalytic subunit Ppp1ca Ppp1a protein protein rat Rattus norvegicus (Rat) Rat MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK pp1g_human Serine/threonine-protein phosphatase PP1-gamma catalytic subunit PPP1CC Protein phosphatase 1C catalytic subunit protein protein human Homo sapiens Human MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK toip1_chlae_protein Torsin-1A-interacting protein 1 TOR1AIP1 LAP1 LAP1B protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt Similar to Q5JTV8 pp1g_chlae_protein Serine/threonine-protein phosphatase PP1-gamma catalytic subunit PPP1CC protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt Similar to P36873 pp1a_chlae_protein Serine/threonine-protein phosphatase PP1-alpha catalytic subunit PPP1CA protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt Similar to P62136 toip1_human Torsin-1A-interacting protein 1 TOR1AIP1 Lamin-associated protein 1B LAP1 protein protein human Homo sapiens Human MAGDGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTPPSRQGRREVRFSDEPPEVYGDFEPLVAKERSPVGKRTRLEEFRSDSAKEEVRESAYYLRSRQRRQPRPQETEEMKTRRTTRLQQQHSEQPPLQPSPVMTRRGLRDSHSSEEDEASSQTDLSQTISKKTVRSIQEAPVSEDLVIRLRRPPLRYPRYEATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQPSVLSSGYQKTPQEWAPQTARIRTRMQNDSILKSELGNQSPSTSSRQVTGQPQNASFVKRNRWWLLPLIAALASGSFWFFSTPEVETTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRSQPAILLLTAARDAEEALRCLSEQIADAYSSFRSVRAIRIDGTDKATQDSDTVKLEVDQELSNGFKNGQNAAVVHRFESFPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGLKEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGLWSRISHLVLPVQPENALKRGICL pp1a-lap1b-1 3578188 N/A 3578196 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3578197 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Fig.3A ppp1ca-tor1aip1-1 3578188 N/A 3578198 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3578197 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig.3 A-B ppp1cc-tor1aip1-1 3578188 N/A 3578199 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3578197 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Fig. 3A ppp1ca-tor1aip1-5 3578188 N/A 3578200 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3578201 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Fig.3C positive control ppp1cc-tor1aip1-2 3578189 N/A 3578198 unspecified role unspecified role bait bait purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 3578197 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2 tor1aip1-ppp1cc-1 3578189 N/A 3578198 unspecified role unspecified role bait bait purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 3578202 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 2 positive control tor1aip1-ppp1cc-2 3578189 N/A 3578198 unspecified role unspecified role prey prey purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 3578197 unspecified role unspecified role bait bait cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false Fig. 5 ppp1cc-tor1aip1-9 3578189 N/A 3578198 unspecified role unspecified role prey prey purified purified spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection N/A 3578203 unspecified role unspecified role bait bait cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false Fig. 5 ppp1ca-tor1aip1-2 3578190 N/A 3578196 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3578197 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table S2 ppp1cc-tor1aip1-3 3578190 N/A 3578198 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3578197 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table S2 ppp1cc-tor1aip1-4 3578190 N/A 3578199 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3578197 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table S2 pp1g-lap1-1 3578191 N/A 3578204 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3578205 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig.4D ppp1cc-tor1aip1-8 3578191 N/A 3578204 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3578206 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig.4D ppp1ca-tor1aip1-4 3578191 N/A 3578205 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3578204 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3578206 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig.4D pp1g-lap1b-1 3578192 N/A 3578197 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3578207 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Fig. 6B, E Despite the quite different subcellular distribution of LAP1B and PP1 isoforms it is evident that they co-localize at specific points within the nucleus and very near to the nuclear envelope ppp1cc-tor1aip1-10 3578192 N/A 3578197 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3578196 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Fig. 6B, E Despite the quite different subcellular distribution of LAP1B and PP1 isoforms it is evident that they co-localize at specific points within the nucleus and very near to the nuclear envelope ppp1cc-tor1aip1-5 3578193 N/A 3578208 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3578209 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 3B ppp1cc-tor1aip1-6 3578193 N/A 3578208 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3578210 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 3B ppp1cc-tor1aip1-7 3578194 N/A 3578211 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3578196 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 3C ppp1ca-tor1aip1-3 3578194 N/A 3578211 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3578207 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 3C ppp1cc-tor1aip1-11 3578195 N/A 3578197 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 3578209 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 4A