IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ fukuda-2010-7 human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Fukuda T., Sugita S., Inatome R., Yanagi S., Fukuda T., Sugita S., Inatome R., Yanagi S. Mouse CAMDI has been given the Uniprot identifier A2AST1 based on stated sequence length and terminal sequences given in Supp. figure 1. [the identity of the protein for Image clone 6831397 is not stated in NCBI databases.] All instances of CAMDI have been entered as being of Murine origin, except for interactions shown in Figure 5, when the Human protein is explicitly used. DISC1 entered here as being of human origin as this is the only DISC1 protein mentioned;Image clone 5756143 corresponds to Uniprot identifier Q9NRI5-3. An approximate sequence for the coiled-coil domains was found by aligning isoforms 1 and 3. Human CAMDI (FLJ26337 clone ) corresponds to protein BAC85242.1 which on Blasting corresponds to aas 576-1450 of Uniprot Q6ZP82. syanagi@ls.toyaku.ac.jp,tfukuda@ls.toyaku.ac.jp The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation fukuda-2010-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Fukuda T., Sugita S., Inatome R., Yanagi S., Fukuda T., Sugita S., Inatome R., Yanagi S. DISC1 entered here as being of human origin as this is the only DISC1 protein mentioned;Image clone 5756143 corresponds to Uniprot identifier Q9NRI5-3. An approximate sequence for the coiled-coil domains was found by aligning isoforms 1 and 3. Mouse CAMDI has been given the Uniprot identifier A2AST1 based on stated sequence length and terminal sequences given in Supp. figure 1. [the identity of the protein for Image clone 6831397 is not stated in NCBI databases.] All instances of CAMDI have been entered as being of Murine origin, except for interactions shown in Figure 5, when the Human protein is explicitly used. DISC1 entered here as being of human origin as this is the only DISC1 protein mentioned;Image clone 5756143 corresponds to Uniprot identifier Q9NRI5-3. An approximate sequence for the coiled-coil domains was found by aligning isoforms 1 and 3. Human CAMDI (FLJ26337 clone ) corresponds to protein BAC85242.1 which on Blasting corresponds to aas 576-1450 of Uniprot Q6ZP82. syanagi@ls.toyaku.ac.jp,tfukuda@ls.toyaku.ac.jp mouse whole brain cDNA library The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation fukuda-2010-3 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Fukuda T., Sugita S., Inatome R., Yanagi S., Fukuda T., Sugita S., Inatome R., Yanagi S. Mouse CAMDI has been given the Uniprot identifier A2AST1 based on stated sequence length and terminal sequences given in Supp. figure 1. [the identity of the protein for Image clone 6831397 is not stated in NCBI databases.] All instances of CAMDI have been entered as being of Murine origin, except for interactions shown in Figure 5, when the Human protein is explicitly used. DISC1 entered here as being of human origin as this is the only DISC1 protein mentioned;Image clone 5756143 corresponds to Uniprot identifier Q9NRI5-3. An approximate sequence for the coiled-coil domains was found by aligning isoforms 1 and 3. Human CAMDI (FLJ26337 clone ) corresponds to protein BAC85242.1 which on Blasting corresponds to aas 576-1450 of Uniprot Q6ZP82. syanagi@ls.toyaku.ac.jp,tfukuda@ls.toyaku.ac.jp The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation fukuda-2010-4 mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fukuda T., Sugita S., Inatome R., Yanagi S., Fukuda T., Sugita S., Inatome R., Yanagi S. Mouse CAMDI has been given the Uniprot identifier A2AST1 based on stated sequence length and terminal sequences given in Supp. figure 1. [the identity of the protein for Image clone 6831397 is not stated in NCBI databases.] All instances of CAMDI have been entered as being of Murine origin, except for interactions shown in Figure 5, when the Human protein is explicitly used. DISC1 entered here as being of human origin as this is the only DISC1 protein mentioned;Image clone 5756143 corresponds to Uniprot identifier Q9NRI5-3. An approximate sequence for the coiled-coil domains was found by aligning isoforms 1 and 3. Human CAMDI (FLJ26337 clone ) corresponds to protein BAC85242.1 which on Blasting corresponds to aas 576-1450 of Uniprot Q6ZP82. syanagi@ls.toyaku.ac.jp,tfukuda@ls.toyaku.ac.jp The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation fukuda-2010-6 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Fukuda T., Sugita S., Inatome R., Yanagi S., Fukuda T., Sugita S., Inatome R., Yanagi S. Mouse CAMDI has been given the Uniprot identifier A2AST1 based on stated sequence length and terminal sequences given in Supp. figure 1. [the identity of the protein for Image clone 6831397 is not stated in NCBI databases.] All instances of CAMDI have been entered as being of Murine origin, except for interactions shown in Figure 5, when the Human protein is explicitly used. DISC1 entered here as being of human origin as this is the only DISC1 protein mentioned;Image clone 5756143 corresponds to Uniprot identifier Q9NRI5-3. An approximate sequence for the coiled-coil domains was found by aligning isoforms 1 and 3. Human CAMDI (FLJ26337 clone ) corresponds to protein BAC85242.1 which on Blasting corresponds to aas 576-1450 of Uniprot Q6ZP82. syanagi@ls.toyaku.ac.jp,tfukuda@ls.toyaku.ac.jp The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation fukuda-2010-5 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Fukuda T., Sugita S., Inatome R., Yanagi S., Fukuda T., Sugita S., Inatome R., Yanagi S. Mouse CAMDI has been given the Uniprot identifier A2AST1 based on stated sequence length and terminal sequences given in Supp. figure 1. [the identity of the protein for Image clone 6831397 is not stated in NCBI databases.] All instances of CAMDI have been entered as being of Murine origin, except for interactions shown in Figure 5, when the Human protein is explicitly used. DISC1 entered here as being of human origin as this is the only DISC1 protein mentioned;Image clone 5756143 corresponds to Uniprot identifier Q9NRI5-3. An approximate sequence for the coiled-coil domains was found by aligning isoforms 1 and 3. Human CAMDI (FLJ26337 clone ) corresponds to protein BAC85242.1 which on Blasting corresponds to aas 576-1450 of Uniprot Q6ZP82. syanagi@ls.toyaku.ac.jp,tfukuda@ls.toyaku.ac.jp The Journal of biological chemistry 2010 Only protein-protein interactions imex curation imex curation a2ast1_mouse Ccdc141 CAMDI protein protein mouse Mus musculus Mouse MSCKESPHVGASTTTVSSVAVHAGDSKIVIAVVKCGKWVRLQLAESQPNLLEIGSSQDETKKLLHDHELLLAKLKALEDRVWELLREADRTAEANKAQSQVYDAMAQTLGEAWATLVSMLERRRELLGLTSEFFQSALEFAIKIDQAEAFLQNPHEFESTEALQSLLLLHDRHAKELLERSLDLLNKSQQLTDFIEKFKCEGSTMNSELIQGAQSSCLKIDSLLELLQDRRRQLDKYLQQQRQELSQVLQLCLWDQQENQVSSWFQKAIRDLQEQSLGASLSDNRELICKHEDLIVKAKEWDSAVEKLKSQALGILLSKDLAGKEHLQLSNQKLNRLQEEFGRLMVERKAWLSMANDFFTSANKSFDVLGKVEAYLKLLKSEGLSLPVLAAKHEELHREIKDSTATALQKGRTLISQVDSCRSRVTGIHEMMGYIQNRVDCLTEQCTAHEEFARKRQQLATSVDDYLRKVEMSIQEIRPILATTLDVASSPSESEKILNKYLELDIQVKETAHALEAAAKIMTEKNELELNEVALLPLKVKWLEEELSTLGRSISCRSRILQTYVAFRKSSEEAEEQLQSLKEFYLTEIPWKDEDDAVVKCQSNSAERKWQLFLKKSFLTQDLSLEFLNLINMAKENEILNVKNEMHIMENIMEKQTNGREELSHLRVAWYLKAIEGKPAREQWEMFKEKLTKTTHSVKLLHEVLMPVSALDLGGSLQSTSDLRRRWIAMKPQLQQLHEDVQQITKEWEVLSSQGAPLKEKAEQLKDLVHLHRRQRERIQEYEEILYKTVQFHQVKEELVHLIKPRELELLAQPMELASSEEVQMQLGRSQERRAHVDHLHQLALTLGVDIISSVQQPNCSNISAKNLQQQLEALELESRSWSAQAKEHERVLSCSLEYCTARDEISELKESFKDIKKKFNNLKFNYSKKNEKSRNLKTLQYQIQQVDTYAEKIQALRKKMEKVNNKTSDSFLSYPSNKANMLSEAMEDLKKNVDDFDKVVTDYKMNLDLTEHLQEVIEECNFWYEDASATVVRVGKYSMECQTREAVDILHRQFNKFITPSVPQQEERIQEVIDLAQRLYGLEEGQKYAEKIVTRHKEILESITELCGSLVELKEKLMQGEVPKMNSDLEDFHDNCIDLLKGPGKDDQKTFSEERNEGQVQGADVLAVNGTREDGLPMDLRRTSSDKEDSAQGLILPEDTLSGEESECISSDDISLPPLPVSPESPLAPSDMEVEELTSSSALALHISGYRMHPGTGGLGKAQESALPSPIAFADGGHSKKDTFTSHFERPYPQLKAESSLASRGSAEMSTKLHINVKCPASMPHEVHDKALQQCSQARESTLEMQEKVHADSNVTKTQDRLHAALDVSPGLGSQPDTSESHQRRVGPQGNKKNSSAENSVVSLAGQAPHFSRLLSNVTVMEGSPVTLEVEVTGFPEPTLTWWVAYNDKP myl9_human Myosin regulatory light polypeptide 9 Myosin regulatory light chain 9 Myosin regulatory light chain MRLC1 Myosin regulatory light chain 2, smooth muscle isoform Myosin RLC MLC-2C 20 kDa myosin light chain MYL9 MRLC1 MYRL2 MLC2 protein protein human Homo sapiens Human MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD q9nri5-3 Disrupted in schizophrenia 1 protein DISC1 KIAA0457 S protein protein human Homo sapiens Human MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGGVSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGIQLRGGTRLPDRLSWPCGPGSAGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSAELSSNSCSPGCGPEVPPTPPGSHSAFTSSFSFIRLSLGSAGERGEAEGCPPSREAESHCQSPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQAARNSSRPERDMHSLPDMDPGSSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEVISLRLKLQKLQEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGATQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLEAKDQQLRREIEEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEITTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNHFWTAKDLTEEIRSLTSEREGLEGLLSKLLVLSSRNVKKLGSVKEDYNRLRREVEHQETAYGYKYCDAESWTQRSQQLA cc141_human Coiled-coil domain-containing protein 141 CCDC141 Coiled-coil protein associated with myosin II and DISC1 CAMDI protein protein human Homo sapiens Human MSSQGSPSVALSTTTVSSVAVQAGDSKIVIAVIKCGKWVQLQLAESQPNLLEIGSSQDETKKLLHDHELLLAKLKALEDRVWELLQEADKTAEENKDQSQVYDAMAETLGEAWAALVSMLERRTELLRLTSEFFENALEFAIKIDQAEDFLQNTHEFESAESLKSLLQLHEHHTKELLERSLALLNKSQQLTDFIEKFKCEGPNVNPELTQGAHSSCLKVDRLLELLQDRRRQLDKYLKQQWQELSQVLQICQWDQQENQVTCWFQKTIRNLQEQSLGSSLSDNEDRIHKQEELIIKAKEWNSAVEKLKSEALRILLSKDYVEKEHLQLSHQKLSQLQEEFGQLMVERNTWLKKANEFFNSANKAFDVLGRVEAYLKLLKSEGLSLAVLAVRHEELHRKIKDCTTDALQKGQTLISQVDSCSSQVSGIHEMMGCIKRRVDHLTEQCSAHKEYALKKQQLTASVEGYLRKVEMSIQKISPVLSNAMDVGSTRSESEKILNKYLELDIQAKETSHELEAAAKTMMEKNEFVSDEMVSLSSKARWLAEELNLFGQSIDYRSQVLQTYVAFLKSSEEVEMQFQSLKEFYETEIPQKEQDDAKAKHCSDSAEKQWQLFLKKSFITQDLGLEFLNLINMAKENEILDVKNEVYLMKNTMENQKAEREELSLLRLAWQLKATESKPGKQQWAAFKEQLKKTSHNLKLLQEALMPVSALDLGGSLQFILDLRQKWNDMKPQFQQLNDEVQYIMKESEELTGRGAPVKEKSQQLKDLIHFHQKQKERIQDYEDILYKVVQFHQVKEELGRLIKSRELEFVEQPKELGDAHDVQIHLRCSQEKQARVDHLHRLALSLGVDIISSVQRPHCSNVSAKNLQQQLELLEEDSMKWRAKAEEYGRTLSRSVEYCAMRDEINELKDSFKDIKKKFNNLKFNYTKKNEKSRNLKALKYQIQQVDMYAEKMQALKRKMEKVSNKTSDSFLNYPSDKVNVLLEVMKDLQKHVDDFDKVVTDYKKNLDLTEHFQEVIEECHFWYEDASATVVRVGKYSTECKTKEAVKILHQQFNKFIAPSVPQQEERIQEATDLAQHLYGLEEGQKYIEKIVTKHKEVLESVTELCESLTELEEKLKQGDVLKMNPNLEDFHYDYIDLLKEPAKNKQTIFNEERNKGQVQVADLLGINGTGEERLPQDLKVSTDKEGGVQDLLLPEDMLSGEEYECVSPDDISLPPLPGSPESPLAPSDMEVEEPVSSSLSLHISSYGVQAGTSSPGDAQESVLPPPVAFADACNDKRETFSSHFERPYLQFKAEPPLTSRGFVEKSTALHRISAEHPESMMSEVHERALQQHPQAQGGLLETREKMHADNNFTKTQDRLHASSDAFSGLRFQSGTSRGYQRQMVPREEIKSTSAKSSVVSLADQAPNFSRLLSNVTVMEGSPVTLEVEVTGFPEPTLTWWVAYNDKP myl9_mouse Myosin regulatory light polypeptide 9 Myl9 Myrl2 Myosin regulatory light chain 9 Myosin regulatory light chain 2, smooth muscle isoform protein protein mouse Mus musculus Mouse MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD mint Plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity disc1_mouse Disrupted in schizophrenia 1 homolog Disc1 protein protein mouse Mus musculus Mouse MQGGGPRGAPIHSPSHGADSGHGLPPAVAPQRRRLTRRPGYMRSTAGSGIGFLSPAVGMPHPSSAGLTGQQSQHSQSKAGQCGLDPGSHCQASLVGKPFLKSSLVPAVASEGHLHPAQRSMRKRPVHFAVHSKNDSRQSERLTGSFKPGDSGFWQELLSSDSFKSLAPSLDAPWNKGSRGLKTVKPLASPALNGPADIASLPGFQDTFTSSFSFIQLSLGAAGERGEAEGCLPSREAEPLHQRPQEMAAEASSSDRPHGDPRHLWTFSLHAAPGLADLAQVTRSSSRQSECGTVSSSSSDTGFSSQDASSAGGRGDQGGGWADAHGWHTLLREWEPMLQDYLLSNRRQLEVTSLILKLQKCQEKVVEDGDYDTAETLRQRLEELEQEKGRLSWALPSQQPALRSFLGYLAAQIQVALHGATQRAGSDDPEAPLEGQLRTTAQDSLPASITRRDWLIREKQRLQKEIEALQARMSALEAKEKRLSQELEEQEVLLRWPGCDLMALVAQMSPGQLQEVSKALGETLTSANQAPFQVEPPETLRSLRERTKSLNLAVRELTAQVCSGEKLCSSLRRRLSDLDTRLPALLEAKMLALSGSCFSTAKELTEEIWALSSEREGLEMFLGRLLALSSRNSRRLGIVKEDHLRCRQDLALQDAAHKTRMKANTVKCMEVLEGQLSSCRCPLLGRVWKADLETCQLLMQSLQLQEAGSSPHAEDEEQVHSTGEAAQTAALAVPRTPHPEEEKSPLQVLQEWDTHSALSPHCAAGPWKEDSHIVSAEVGEKCEAIGVKLLHLEDQLLGAMYSHDEALFQSLQGELQTVKETLQAMILQLQPTKEAGEASASYPTAGAQETEA ccdc141-disc1-6 3578519 N/A 3578525 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3578526 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed P24844:p.Thr19_Ser20delinsAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false P24844:p.Thr19_Ser20delinsAspAsp mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 4 A/B ccdc141-myl9-2 3578519 N/A 3578527 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3578526 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3578525 unspecified role unspecified role ancillary ancillary over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false figure 4 D DISC1 was found to interact with MRLC in a CAMDI-dependent manner. ccdc141-myl9-3 3578519 N/A 3578528 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q6ZP82:p.Arg828Trp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false N/A 3578526 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 5B the interaction of R828W with MRLC or MRLC-DD was significantly attenuated. ccdc141-myl9-4 3578519 N/A 3578528 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Q6ZP82:p.Arg828Trp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false N/A 3578527 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false figure 5B disc1-ccdc141-1 3578520 N/A 3578525 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed coiled-coil domains sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 3578527 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed coiled-coil domains sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false no figure Using the CAMDI coiled-coil domain as bait, several CAMDI-binding candidates were found including MRLC 2a. disc1-ccdc141-2 3578520 N/A 3578529 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3578527 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed coiled-coil domains sufficient to bind sufficient binding region sufficient to bind range range range range false physical association physical association false false false no figure Using the CAMDI coiled-coil domain as bait, several CAMDI-binding candidates were found including MRLC 2a. ccdc141-disc1-1 3578521 N/A 3578525 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3578527 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false figure 1B disc1-ccdc141-3 3578521 N/A 3578527 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3578525 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed M2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 1C ccdc141-disc1-2 3578522 N/A 3578525 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3578530 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false figure 1B ccdc141-disc1-7 3578522 N/A 3578529 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Ser20 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false N/A 3578525 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false figure 4A The antibody used to detect "p-MRLC" is not stated;Cell Signalling sell several antibodies which detect both MRLC phosphorylated at pSer 20 only, but also phosphorylated at both Thr19 and Ser20. Thus Thr19 may also be phosphorylated. ccdc141-disc1-5 3578523 N/A 3578525 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3578527 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false figure 2A ccdc141-disc1-3 3578523 N/A 3578525 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3578526 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level Ser20 phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false figure 4C The antibody used to detect "p-MRLC" is not stated;Cell Signalling sell several antibodies which detect both MRLC phosphorylated at pSer 20 only, but also phosphorylated at both Thr19 and Ser20. Thus Thr19 may also be phosphorylated. Co-expression of CAMDI with DISC1 induced p-MRLC accumulation at/around the centrosome. ccdc141-disc1-4 3578524 N/A 3578525 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false N/A 3578527 unspecified role unspecified role bait bait purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false CC2_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 1D