IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tiwary-2010-1 human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Tiwary R., Yu W., Li J., Park SK., Sanders BG., Kline K. crosslinked cells were subjected to Chromatin immunoprecipiation (ChIP) assay. crosslinker: 1% formaldehyde k.kline@mail.utexas.edu PloS one 2010 Only protein-protein interactions imex curation imex curation tr10b_human_gene Tumor necrosis factor receptor superfamily member 10B TNFRSF10B DR5 KILLER TRAILR2 TRICK2 ZTNFR9 gene gene human Homo sapiens Human ddit3_human DNA damage-inducible transcript 3 protein CHOP10 C/EBP-homologous protein DDIT3 CHOP GADD153 Growth arrest and DNA damage-inducible protein GADD153 C/EBP-homologous protein 10 C/EBP zeta CCAAT/enhancer-binding protein homologous protein protein protein human Homo sapiens Human MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA 31905293FB1FBBE2 chop-dr5-1 3541330 N/A 3541331 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3541332 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 1E alpha-TEA (RRR- a-Tocopheryloxyacetic acid is a nonhydrolyzable ether analog of RRR-a-tocopherol, a pro-apoptotic agent .)