IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ de-2009-17 in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift weight by staining molecular weight estimation by staining weight by staining de Vooght KM., van Solinge WW., van Wesel AC., Kersting S., van Wijk R. k.devooght@umcutrecht.nl Haematologica 2009 Only protein-protein interactions imex curation imex curation de-2009-18 human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr de Vooght KM., van Solinge WW., van Wesel AC., Kersting S., van Wijk R. k.devooght@umcutrecht.nl Haematologica 2009 Only protein-protein interactions imex curation imex curation jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF hk1_promoter human_hk1_promoter nucleic acid nucleic acid human Homo sapiens Human hxk1_human_gene Hexokinase-1 HK1 gene gene human Homo sapiens Human hk1_promoter-jun-1 3576969 N/A 3576971 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep cell lysate cell lysate human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells N/A 3576972 unspecified role unspecified role bait bait purified purified n.11A>G NG_012077.1:g.50763A>G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 10:69315752-69315772 chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Figure 3b hk1-jun-1 3576970 N/A 3576971 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3576973 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Forward primer: 5’-AACAGAGAGGGGACACAGCA-3’ Reverse primer: 5’-TGGTAGAGTTTTGAGCCAGG-3’ 10:69315646-69315873 physical association physical association false false false Figure 4