IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tsodikov-2007-1 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Tsodikov OV., Ivanov D., Orelli B., Staresincic L., Shoshani I., Oberman R., Schärer OD., Wagner G., Ellenberger T. Interactions involving artificial DNA constructs have not been captured. Protein-protein interactions that are measured in these DNA containing experiments are all captured through the experiments that have been curated. tome@biochem.wustl.edu The EMBO journal 2007 Only protein-protein interactions imex curation imex curation tsodikov-2007-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight identificat confirmation by molecular weight weight identificat Tsodikov OV., Ivanov D., Orelli B., Staresincic L., Shoshani I., Oberman R., Schärer OD., Wagner G., Ellenberger T. Interactions involving artificial DNA constructs have not been captured. Protein-protein interactions that are measured in these DNA containing experiments are all captured through the experiments that have been curated. tome@biochem.wustl.edu The EMBO journal 2007 Only protein-protein interactions imex curation imex curation tsodikov-2007-5 in vitro In vitro cosedimentation cosedimentation predetermined predetermined participant predetermined Tsodikov OV., Ivanov D., Orelli B., Staresincic L., Shoshani I., Oberman R., Schärer OD., Wagner G., Ellenberger T. Interactions involving artificial DNA constructs have not been captured. Protein-protein interactions that are measured in these DNA containing experiments are all captured through the experiments that have been curated. tome@biochem.wustl.edu The EMBO journal 2007 Only protein-protein interactions imex curation imex curation ercc1_human DNA excision repair protein ERCC-1 ERCC1 protein protein human Homo sapiens Human MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTYAEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP xpa_human DNA repair protein complementing XP-A cells XPA XPAC Xeroderma pigmentosum group A-complementing protein protein protein human Homo sapiens Human MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM ercc1-xpa-1 3582721 N/A 3582724 unspecified role unspecified role neutral component neutral component purified purified Binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 13C radiolabelled 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 15N radiolabelled 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 N/A 3582725 unspecified role unspecified role neutral component neutral component purified purified Binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 13C radiolabelled 13c label 13c label C13 13C C13 13C undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 15N radiolabelled 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 3582732 3582728 direct interaction direct interaction false false false Figs.1, 2 and 3 ercc1-xpa-4 3582722 N/A 3582724 unspecified role unspecified role neutral component neutral component purified purified Binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 N/A 3582725 unspecified role unspecified role neutral component neutral component purified purified Binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 3582739 3582737 direct interaction direct interaction false false false Fig.S1A and B ercc1-xpa-5 3582723 N/A 3582724 unspecified role unspecified role neutral component neutral component purified purified Binding domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 N/A 3582725 unspecified role unspecified role neutral component neutral component purified purified Binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecobd Escherichia coli (strain B / BL21-DE3) Stoichiometry: 1.0 3582744 3582742 direct interaction direct interaction false false false Fig.S1C