IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ellis-2006-1 human-293 flp-in Homo sapiens 293 flp-in 293 flp-in fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Ellis J., Pediani JD., Canals M., Milasta S., Milligan G. HEK293 Flp-In T-REx cells;Expression of VSV-G-h-orexin-1-eYFP in these cells is entirely dependent upon addition of doxycycline. g.milligan@bio.gla.ac.uk. The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation ellis-2006-2 human-293 flp-in Homo sapiens 293 flp-in 293 flp-in fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Ellis J., Pediani JD., Canals M., Milasta S., Milligan G. HEK293 Flp-In T-REx cells;Expression of VSV-G-h-orexin-1-eYFP in these cells is entirely dependent upon addition of doxycycline. g.milligan@bio.gla.ac.uk. The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation orex_human Orexin HCRT OX PPORX PPOX Hypocretin protein protein human Homo sapiens Human MNLPSTKVSWAAVTLLLLLLLLPPALLSSGAAAQPLPDCCRQKTCSCRLYELLHGAGNHAAGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRPCLGRRCSAPAAASVAPGGQSGI cnr1_human Cannabinoid receptor 1 CNR1 CNR CANN6 protein protein human Homo sapiens Human MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL cnr1-hcrt-1 3576608 N/A 3576610 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminus eyfp enhanced yellow fluorescent protein tag eyfp c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3576611 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed C-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 4A/B, 8B. cnr1-hcrt-2 3576609 N/A 3576610 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed n-terminus vsv tag vsv tag vesicular stomatitis virus tag vesicular stomatitis virus tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false C-terminus eyfp enhanced yellow fluorescent protein tag eyfp c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3576611 unspecified role unspecified role fluorescence donor fluorescence donor over-expressed over expressed level over-expressed C-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Figure 4C Treatment with SR-141716A/Rimonabant (a CB1 receptor antagonist/inverse agonist ) allowed detection of protein-protein interactions at the cell surface.