DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ kissinger-2004-1 ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction experimental particp experimental participant identification experimental particp Kissinger CR., Rejto PA., Pelletier LA., Thomson JA., Showalter RE., Abreo MA., Agree CS., Margosiak S., Meng JJ., Aust RM., Vanderpool D., Li B., Tempczyk-Russell A., Villafranca JE. villafranca.ernie@sbcglobal.net Journal of molecular biology 2004 imex curation Only protein-protein interactions imex curation q99714-1 3-hydroxyacyl-CoA dehydrogenase type-2 HSD17B10 ERAB HADH2 MRPP2 SCHAD SDR5C1 XH98G2 2-methyl-3-hydroxybutyryl-CoA dehydrogenase 3-hydroxy-2-methylbutyryl-CoA dehydrogenase 3-hydroxyacyl-CoA dehydrogenase type II Endoplasmic reticulum-associated amyloid beta-peptide-binding protein Mitochondrial ribonuclease P protein 2 Short chain dehydrogenase/reductase family 5C member 1 Short-chain type dehydrogenase/reductase XH98G2 Type II HADH 17-beta-estradiol 17-dehydrogenase 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)) 3alpha(or 20beta)-hydroxysteroid dehydrogenase 7-alpha-hydroxysteroid dehydrogenase protein protein human Homo sapiens Human MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP hsd17b10-1 3547025 N/A 3547026 predetermined predetermined participant predetermined structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified Q99714-1:p.Cys214Arg C214R mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 4.0 covalent binding covalent binding false false false Fig 1, Table 1