IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ akazawa-2004-2 chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Akazawa H., Kudoh S., Mochizuki N., Takekoshi N., Takano H., Nagai T., Komuro I. From PMID:10075728 gst-csx/nkx2-5 is human. From PMID: 8888684 ha-csx/nkx2-5 is human. komuro-tyk@umin.ac.jp The Journal of cell biology 2004 Only protein-protein interactions imex curation imex curation akazawa-2004-3 in vitro In vitro pull down pull down autoradiography autoradiography Akazawa H., Kudoh S., Mochizuki N., Takekoshi N., Takano H., Nagai T., Komuro I. From PMID:10075728 gst-csx/nkx2-5 is human. From PMID: 8888684 ha-csx/nkx2-5 is human. komuro-tyk@umin.ac.jp The Journal of cell biology 2004 Only protein-protein interactions imex curation imex curation akazawa-2004-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Akazawa H., Kudoh S., Mochizuki N., Takekoshi N., Takano H., Nagai T., Komuro I. From PMID:10075728 gst-csx/nkx2-5 is human. From PMID: 8888684 ha-csx/nkx2-5 is human. komuro-tyk@umin.ac.jp human heart library The Journal of cell biology 2004 Only protein-protein interactions imex curation imex curation fbli1_mouse Filamin-binding LIM protein 1 Fblim1 Cal CSX-associated LIM protein protein mouse Mus musculus Mouse MASKPEKRVASSVFITLAPPRRDVAVSEEVGQAACEARRARPWEMLPTKTPGAAVGRSPKTWTPSGKTNASLSGVTPQLSNGGCSLPPPSLNEEDLDLPPPPPPPSAYLPLPEEEPPVLPGKSLISDLEQLHLPPPPPPPPPQAPSKGSSVHPPPGHAIPSEEELPPPPEEPVTLPEREVSTDVCGFCHKPVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQRFYQKDGRPLCEPCYQDTLEKCGKCGEVVQEHVIRALGKAFHPPCFTCVTCARCISDESFALDSQNQVYCVADFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCSVLLSVEPTDQGCYPLNDHLFCKPCHLKRSAAGCC mint Serves as an anchoring site for cell-ECM adhesion proteins and filamin-containing actin filaments. Is implicated in cell shape modulation (spreading) and motility. May participate in the regulation of filamin-mediated cross-linking and stabilization of actin filaments. May also regulate the assembly of filamin-containing signaling complexes that control actin assembly nkx25_human Homeobox protein Nkx-2.5 NKX2-5 CSX NKX2.5 NKX2E Homeobox protein NK-2 homolog E Cardiac-specific homeobox Homeobox protein CSX protein protein human Homo sapiens Human MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW fbli1_human Filamin-binding LIM protein 1 FBLIM1 FBLP1 Migfilin Mitogen-inducible 2-interacting protein protein protein human Homo sapiens Human MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAAATVPAAPMQLFNGGCPPPPPVLDGEDVLPDLDLLPPPPPPPPVLLPSEEEAPAPMGASLIADLEQLHLSPPPPPPQAPAEGPSVQPGPLRPMEEELPPPPAEPVEKGASTDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQLAGQSFYQKDGRPLCEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHVKRSAAGCC csx-1 3579636 N/A 3579639 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3579640 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2A fblim1-nkx2_5-3 3579636 N/A 3579639 unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 3579640 unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 6B fblim1-nkx2_5-1 3579637 N/A 3579639 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3579640 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range sufficient to bind sufficient binding region sufficient to bind range range range range false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association false false false Fig. 2B fblim1-nkx2_5-2 3579637 N/A 3579639 unspecified role unspecified role prey prey cell lysate cell lysate in vitro translated in vitro translated protein in vitro translated region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false 35s radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false range sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes N/A 3579640 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 2C We also examined the binding of GST-CSX/NKX2-5 and in vitro–translated Cal and its mutants. A Cal mutant lacking all three LIM domains did not associate with CSX/NKX2-5, but Cal mutants containing at least two LIM domains did associate with CSX/NKX2-5 (Fig. 2 C). These results suggest that the LIM domains of Cal are responsible for interaction with CSX/NKX2-5. cal-csx-1 3579638 N/A 3579640 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell N/A 3579641 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false na