DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ stasiak-2000-1 in vitro In vitro tem transmission electron microscopy tem experimental particp experimental participant identification experimental particp Stasiak AZ., Larquet E., Stasiak A., Müller S., Engel A., Van Dyck E., West SC., Egelman EH. Due to the function of IntAct, the methods entered at the experimental level would get wiped out when a different method is entered at the participant level. To overcome this, we put 'experimental' at the experiment level, and fill participant id for each participant. I wanted to stay consistent with this even if there is polymer is comprised of the same monomeric units. I saw that the protein has the imex id IM-27613 in each experiment. May you kindly let me know if I am still missing any of the ids please? Thank you! egelman@virginia.edu Current biology : CB 2000 Only protein-protein interactions imex curation imex curation stasiak-2000-2 in vitro In vitro 3d-em-tomo electron tomography 3D-EM-tomo experimental particp experimental participant identification experimental particp Stasiak AZ., Larquet E., Stasiak A., Müller S., Engel A., Van Dyck E., West SC., Egelman EH. Due to the function of IntAct, the methods entered at the experimental level would get wiped out when a different method is entered at the participant level. To overcome this, we put 'experimental' at the experiment level, and fill participant id for each participant. I wanted to stay consistent with this even if there is polymer is comprised of the same monomeric units. I saw that the protein has the imex id IM-27613 in each experiment. May you kindly let me know if I am still missing any of the ids please? Thank you! egelman@virginia.edu Current biology : CB 2000 Only protein-protein interactions imex curation imex curation rad52_human DNA repair protein RAD52 homolog RAD52 protein protein human Homo sapiens Human MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHSTPVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS rad52-6 3650775 N/A 3650777 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection Stoichiometry: 7.0 direct interaction direct interaction false false false Figure 1, Figure 4 rad52-7 3650776 N/A 3650777 structure determination identification by structure determination identification by structure determination structure determination unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection Stoichiometry: 7.0 direct interaction direct interaction false false false Figure 2a, Figure 3, Figure S1