DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ baradaran-2018-1 picpa Pichia pastoris (Yeast) Yeast Pichia pastoris 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org Nature 2018 imex curation Only protein-protein interactions imex curation baradaran-2018-2 picpa Pichia pastoris (Yeast) Yeast Pichia pastoris crosslink cross-linking study crosslink predetermined predetermined participant predetermined Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org Nature 2018 imex curation Only protein-protein interactions imex curation baradaran-2018-3 human-293s_gnti HEK293S GnTI -adenovirus 5 transformed, glycosylation deficient Human 293s_gnti HEK293S GnTI -adenovirus 5 transformed, glycosylation deficient ATCC® CRL-3022 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org Nature 2018 imex curation Only protein-protein interactions imex curation baradaran-2018-4 human-293s_gnti HEK293S GnTI -adenovirus 5 transformed, glycosylation deficient Human 293s_gnti HEK293S GnTI -adenovirus 5 transformed, glycosylation deficient ATCC® CRL-3022 crosslink cross-linking study crosslink predetermined predetermined participant predetermined Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org Nature 2018 imex curation Only protein-protein interactions imex curation baradaran-2018-5 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. crosslink cross-linking study crosslink predetermined predetermined participant predetermined Baradaran R., Wang C., Siliciano AF., Long SB. longs@mskcc.org Nature 2018 imex curation Only protein-protein interactions imex curation w2sde2_9euro Calcium uniporter protein HMPREF1541_00236 protein protein Cyphellophora europaea CBS 101466 Cyphellophora europaea CBS 101466 MTKGKLLTTPSRLLKLVLPLSTVDHNTDRKDVAPLALLVHPQQPLSYLERLIQAELPPPDPQDSKSTTRSVTFRAMEAKDDEIKPRKKADTEGGGGSDGSVQSYSGAGREGEGKDEGEFVRWSPSTEIGDFIRDAARAKEFEVEIEGSPGVIKVAVPSFNDRTYYLRQRLRRTSRKISKLAAIKEECDKAAHRGAQRIALAGCGGLIGYWYIVYRLTFETDLGWDVMEPVTYLVGLSTLIGGYMWFLWHNREVSYRSALNITVSARQNKLYQAKGFSLQDWEGYLEEANAMRREIKAVASEYDVDWNETQDEGGDEKVTKALRDERKNNNGTKNKSKEGEEDDEDD mcu_danre Calcium uniporter protein, mitochondrial mcu zgc:153607 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MAAKVCRSVLLLSRSSGAVASSAYPAFGVSSQRHQGTKTEALSMSLGGHQTVRRAHGLRTGGRCALFCHPSATLTAQGWKGSPSWQVQRLLCSPAAEDVSVVYQNGLPVISVRLPSRRERCQFTLKPLSDTVGVFLQQLQAEDRGIDRVTIYSADGARIASSTGIDILLMDNFKLVINDTSYLVQPPRRDLLPHEDGERLNDVKILVQQLYTTLRIEEHQLNKERELIGRLEDLNSQLQPLEKVKEELSKKAERRTTWVLWGGMAYMATQFGILARLTWWEYSWDIMEPVTYFITYGTAMAMYAYFVLTRQEYLYPDARDRQYLLFFHRGAKRTRFDIEKYNKLKDAIAEAELDLKRLRDPLQLNLPIQQIDTSKD q8ne86-1 Calcium uniporter protein, mitochondrial MCU C10orf42 CCDC109A Coiled-coil domain-containing protein 109A protein protein human Homo sapiens Human MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRTVHQRIASWQNLGAVYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPISDSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPKRDLLSHENAATLNDVKTLVQQLYTTLCIEQHQLNKERELIERLEDLKEQLAPLEKVRIEISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYFVMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVHLPLRQIGEKD w2sde2_9euro-1 3468757 N/A 3468762 unspecified role unspecified role neutral component neutral component purified purified GEGEEF tag GEGEEF tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 4.0 direct interaction direct interaction false false false Fig 1, Extended Data Table 1 w2sde2_9euro-2 3468758 N/A 3468762 unspecified role unspecified role neutral component neutral component purified purified GEGEEF tag GEGEEF tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 4.0 direct interaction direct interaction false false false Extended Data Fig 2h mcu-1 3468759 N/A 3468763 unspecified role unspecified role neutral component neutral component purified purified TETSQVAPA tag 1D4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 4.0 direct interaction direct interaction false false false Fig 2 mcu-6 3468760 N/A 3468763 unspecified role unspecified role neutral component neutral component purified purified TETSQVAPA tag 1D4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Stoichiometry: 4.0 direct interaction direct interaction false false false Fig 2J mcu-7 3468761 N/A 3468764 unspecified role unspecified role neutral component neutral component purified purified TETSQVAPA tag 1D4 tag tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 4.0 direct interaction direct interaction false false false Extended Data Fig 2i