UniProt UniProt http://www.uniprot.org zhao-2017-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhao Y., Li X., Huang T., Jiang LL., Tan Z., Zhang M., Cheng IH., Wang X., Bu G., Zhang YW., Wang Q., Xu H. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of PSEN-1 taken from PMID:8755489 traced back through references wangqi@gzucm.edu.cn,xuh@sbpdiscovery.org Experimental & molecular medicine 2017 imex curation Only protein-protein interactions imex curation zhao-2017-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhao Y., Li X., Huang T., Jiang LL., Tan Z., Zhang M., Cheng IH., Wang X., Bu G., Zhang YW., Wang Q., Xu H. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of PSEN-1 taken from PMID:8755489 traced back through references wangqi@gzucm.edu.cn,xuh@sbpdiscovery.org Experimental & molecular medicine 2017 imex curation Only protein-protein interactions imex curation zhao-2017-3 mouse-bv2 Mouse BV2 glioma cells bv2 Mouse microglial BV2 cells mouse, C57BL/6; Tissue: brain, microglial cells; Transformed by: retroviruses; transformed by recombinant retrovirus (v-raf/v-mic) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao Y., Li X., Huang T., Jiang LL., Tan Z., Zhang M., Cheng IH., Wang X., Bu G., Zhang YW., Wang Q., Xu H. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of PSEN-1 taken from PMID:8755489 traced back through references wangqi@gzucm.edu.cn,xuh@sbpdiscovery.org Experimental & molecular medicine 2017 imex curation Only protein-protein interactions imex curation zhao-2017-4 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down western blot western blot Immuno blot Immuno blot Zhao Y., Li X., Huang T., Jiang LL., Tan Z., Zhang M., Cheng IH., Wang X., Bu G., Zhang YW., Wang Q., Xu H. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of PSEN-1 taken from PMID:8755489 traced back through references wangqi@gzucm.edu.cn,xuh@sbpdiscovery.org Experimental & molecular medicine 2017 imex curation Only protein-protein interactions imex curation zhao-2017-5 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Zhao Y., Li X., Huang T., Jiang LL., Tan Z., Zhang M., Cheng IH., Wang X., Bu G., Zhang YW., Wang Q., Xu H. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of PSEN-1 taken from PMID:8755489 traced back through references wangqi@gzucm.edu.cn,xuh@sbpdiscovery.org Experimental & molecular medicine 2017 imex curation Only protein-protein interactions imex curation zhao-2017-6 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhao Y., Li X., Huang T., Jiang LL., Tan Z., Zhang M., Cheng IH., Wang X., Bu G., Zhang YW., Wang Q., Xu H. Alzheimers - Interactions investigated in the context of Alzheimers disease Source of PSEN-1 taken from PMID:8755489 traced back through references wangqi@gzucm.edu.cn,xuh@sbpdiscovery.org Experimental & molecular medicine 2017 imex curation Only protein-protein interactions imex curation psn1_human Presenilin-1 PSEN1 AD3 PS1 PSNL1 Protein S182 protein protein human Homo sapiens Human MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYITVALLIWNFGVVGMISIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSKNSKYNAESTERESQDTVAENDDGGFSEEWEAQRDSHLGPHRSTPESRAAVQELSSSILAGEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCLTLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI trem2_human Triggering receptor expressed on myeloid cells 2 TREM2 Triggering receptor expressed on monocytes 2 protein protein human Homo sapiens Human MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT nica_human Nicastrin NCSTN KIAA0253 UNQ1874/PRO4317 protein protein human Homo sapiens Human MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTFSINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY nica_mouse Nicastrin Ncstn protein protein mouse Mus musculus Mouse MATTRGGSGPDPGSRGLLLLSFSVVLAGLCGGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLKWVLTDGPNPPYMVLLEGKLFTRDVMEKLKGTTSRIAGLAVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCKKTLWNELGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLGQNGSAPSFPLCAMQLFSHMHAVISTATCMRRSFIQSTFSINPEIVCDPLSDYNVWSMLKPINTSVGLEPDVRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALHKAPDVTTLSRNVMFVFFQGETFDYIGSSRMVYDMENGKFPVRLENIDSFVELGQVALRTSLDLWMHTDPMSQKNESVKNQVEDLLATLEKSGAGVPEVVLRRLAQSQALPPSSLQRFLRARNISGVVLADHSGSFHNRYYQSIYDTAENINVTYPEWQSPEEDLNFVTDTAKALANVATVLARALYELAGGTNFSSSIQADPQTVTRLLYGFLVRANNSWFQSILKHDLRSYLDDRPLQHYIAVSSPTNTTYVVQYALANLTGKATNLTREQCQDPSKVPNESKDLYEYSWVQGPWNSNRTERLPQCVRSTVRLARALSPAFELSQWSSTEYSTWAESRWKDIQARIFLIASKELEFITLIVGFSTLVFSLIVTYCINAKADVLFVAPREPGAVSY trem2_mouse Triggering receptor expressed on myeloid cells 2 Trem2 Trem2a Trem2b Trem2c Triggering receptor expressed on monocytes 2 protein protein mouse Mus musculus Mouse MGPLHQFLLLLITALSQALNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTSILLLLACVLLSKFLAASILWAVARGRQKPGTPVVRGLDCGQDAGHQLQILTGPGGT trem2-psen1-2 3488019 N/A 3488025 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P49768:p.Asp385Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false N/A 3488026 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 1A, 1D, 1E Confirmation that PSEN1 was cleaved into chains was by molecular weight in addition to antibody staining. Inhibition of gamma- secretase activity did not affect PS1/TREM2 co-precipitation psen1-trem2-1 3488020 N/A 3488025 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3488026 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3488027 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. 1B Confirmation that PSEN1 was cleaved into chains was by molecular weight in addition to antibody staining. psen1-trem2-2 3488021 N/A 3488028 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3488029 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 1C trem2-psen1-1 3488022 N/A 3488025 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3488026 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false transmembrane region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1G trem2-psen1-3 3488023 N/A 3488025 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N/A 3488026 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed Q9NZC2:p.Thr66Met mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9NZC2:p.Arg47His mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q9NZC2:p.Thr96Lys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false Fig. 2A-2C Confirmation that PSEN1 was cleaved into chains was by molecular weight in addition to antibody staining. Inhibition of gamma- secretase activity did not affect PS1/TREM2 co-precipitation psen1-trem2-3 3488024 N/A 3488025 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3488026 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Q9NZC2:p.Thr66Met mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q9NZC2:p.Arg47His mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Q9NZC2:p.Thr96Lys mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false N/A 3488027 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. 2D