DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ cotton-2018-2 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk The EMBO journal 2018 imex curation Only protein-protein interactions imex curation cotton-2018-3 in vitro In vitro sls static light scattering sls predetermined predetermined participant predetermined Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk The EMBO journal 2018 imex curation Only protein-protein interactions imex curation cotton-2018-4 in vitro In vitro comigration in sds comigration in sds page comigration in sds weight by staining molecular weight estimation by staining weight by staining Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk The EMBO journal 2018 imex curation Only protein-protein interactions imex curation cotton-2018-1 ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk The EMBO journal 2018 imex curation Only protein-protein interactions imex curation cotton-2018-5 in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Cotton TR., Fischer G., Wang X., McCoy JC., Czepnik M., Thompson TB., Hyvönen M. mh256@cam.ac.uk The EMBO journal 2018 imex curation Only protein-protein interactions imex curation gdf8_human Growth/differentiation factor 8 MSTN GDF8 Myostatin protein protein human Homo sapiens Human MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS mint homomint o14793-pro_0000033951 Growth/differentiation factor 8 Myostatin MSTN GDF8 protein protein human Homo sapiens Human DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS 267 375 o14793-pro_0000033950 MSTN GDF8 Myostatin protein protein human Homo sapiens Human NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRR 24 266 mstn-2 3470789 N/A 3470794 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Figure 1A mstn-mstn-1 3470789 N/A 3470795 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3470796 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Figure 1A mstn-3 3470790 N/A 3470794 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Figure 1A mstn-mstn-2 3470790 N/A 3470795 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 N/A 3470796 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 direct interaction direct interaction false false false Figure 1A mstn-4 3470791 N/A 3470794 unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 covalent binding covalent binding false false false Figure 1A mstn-5 3470791 N/A 3470795 unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false Figure 1A mstn-6 3470792 N/A 3470794 unspecified role unspecified role neutral component neutral component purified purified O14793:p.[Lys217Ala;Gln218Ala;Glu220Ala;Gln319Ala;Lys320Ala] Q319A,K320A,K217A,Q218A,E220A mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Figure 3A, Table 1 mstn-mstn-3 3470793 N/A 3470795 unspecified role unspecified role neutral component neutral component purified purified N/A 3470796 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false direct interaction direct interaction false false false Figure 2A