MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint zou-2017-1 ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zou Y., Li Y., Dillon JR. yinan.zou@usask.ca BMC microbiology 2017 Only protein-protein interactions imex curation imex curation zou-2017-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Zou Y., Li Y., Dillon JR. yinan.zou@usask.ca BMC microbiology 2017 Only protein-protein interactions imex curation imex curation zou-2017-3 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zou Y., Li Y., Dillon JR. yinan.zou@usask.ca BMC microbiology 2017 Only protein-protein interactions imex curation imex curation a0a1d3ii56_neigo Probable peptidoglycan glycosyltransferase FtsW WHOM_01250 WHOM_01577C ftsW E8M63_08595 Cell division protein FtsW Cell wall polymerase Peptidoglycan polymerase protein protein neigo Neisseria gonorrhoeae MKISEVLVKVGDGVHTLLLDRPIVRDGRKFDAPLLWMVVLMTAFGLLMIYSASVYLASKEGGDQFFYLTRQAGFVVAGLIASGFLWFLCRMRTWRRLVPWIFALSGLLLVAVLIAGREINGATRWIPLGPLNFQPTELFKLAVILYLASLFTRREEVLRSMESLGWQSIWRGTANLIMSATNPQARRETLEMYGRFRAIILPIMLVAFGLVLIMVQPDFGSFVVITVITVGMLFLAGLPWKYFFVLVGSVLGGMVLMITAAPYRVQRVVAFLDPWKDPQGAGYQLTHSLMAIGRGEWFGMGLGASLSKRGFLPEAHTDFIFAIIAEEFGFFGMCVLIFCYGWLVVRAFSIGKQSRDLGLTFNAYIASGIGIWIGIQSFFNIGVNIGALPTKGLTLPLMSYGGSSVFFMLISMMLLLRIDYENRRKMRGYRVE ftsz_neigo Cell division protein FtsZ ftsZ protein protein neigo Neisseria gonorrhoeae MEFVYDVAESAVSPAVIKVIGLGGGGCNAINNMVANNVRSVEFISANTDAQSLAKNHAAKRIQLGTNLTRGLGAGANPDIGRAAAQEDREAIEEAIRGANMLFITTGMGGGTGTGSAPVVAEIAKSLGILTVAVVTRPFSYEGKRVHVAQAGLEQLKEHVDSLIIIPNDKLMTALGEDVTMREAFRAADNVLRDAVAGISEVVTCPSEIINLDFADVKTVMSNRGIAMMGSGYAQGIDRARMATDQAISSPLLDDVTLDGARGVLVNITTAPGCLKMSELSEVMKIVNQSAHPDLECKFGAAEDETMSEDAIRITIIATGLKEKGAVDPTPEREVEAVAPSKQEQSHIVEGMIRTNRGIRTMNLTAADFDNQSVLDDFEIPAILRRQHNSDK a0a1d3ieb2_neigo Cell division protein FtsA WHOM_01245 WHOM_01572C ftsA E8M63_08620 WHOF_00744 WHOF_01786C protein protein neigo Neisseria gonorrhoeae MEQQKRYISVLDIGTSKVLALIGEVQDDDKINIIGLGQAPSRGLRAGMVTNIDATVQAIRQAVNDAELMADTKITHVTTGIAGNHIRSLNSQGVVKIKDGEVTQADIDRAIETAKAINIPPDQKILDAVVQDYIIDTQLGVREPIGMSGVRLDTRVHIITGASTAVQNVQKCIELCGLKSDQIMLQPLASGQAVLTEDEKDLGVCVIDIGGGTTDIAVYMNGAIRHTSVIPAGGNLITKDLSKSLRTPLDAAEYIKIHYGVASCDTEGLGEMIEVPGVGDRTSRQVSSKVLAAIISARIQEIFGVVLGELQKSGFPKEVLNAGIVLTGGVSMMTGIVEFAEKIFDLPVRTGAPQEMGGLSDRVRTPRFSTAIGLLHAACKLEGNLPQPENGTVQEREGGGGLLARLKRWIENNL q50991_neigo tpc WHOF_00219 WHOF_00284C protein protein neigo Neisseria gonorrhoeae MSENKQNEVLTGYEQLKRRNRRRLVTASSLVAASCILLAAALSSDPADSNPAPQAGETGATESQTANTAQTPALKSAAENGETAADKPQDLAGEDKPSAADSEISEPENVGAPLVLINDRLEDSNIKGLEESEKLQQAETAKTEPKQAKQRAAEKVSATADSTDTVAVEKPKRSAEPKPQKAERTAEAKPKAKETKTAEKVADKPKTAAEKTKPDTAKSDSAVKEAKKADKAEGKKTAEKDRSDGKKHETAQKTDKADKTKTAEKEKSGKAGKKAAIQAGYAEKERALSLQRKMKAAGIDSTITEIMTDNGKVYRVKSSNYKNARDAERDLNKLRVHGIAGQVTNE a0a1d3fij4_neigo Cell division protein FtsQ WHOM_01246 ftsQ E8M63_08615 WHOF_00743 WHOF_01787C WHOM_01573C protein protein neigo Neisseria gonorrhoeae MWDNAEAMERLTRWLLVMMAMLLAASGLVWFYNSNHLPVKQVSLKGNLVYSDKKALGSLAKEYIHGNILRTDINGAQEAYRRYPWIASVMVRRRFPDTVEVVLTERKPVARWGDHALVDGEGNVFEARLDRPGMPVFRGAEGTSAEMLRRYDEFSTVLAKQGLGIKEMTYTARSAWNVVLDNGITVRLGRENEMKRLRLFTEAWQHLLRKNKNRLSYVDMRYKDGFSVRHAPDGLPEKESEE a0a4t9uxi5_neigo ftsK_1 VT05_00329 protein protein neigo Neisseria gonorrhoeae MTEKSHKKTAKGRAGSPSPTSARNKKADNGARGNKVSERLKAVKELQKTETKKARPEHVVNLIADALWLMGLAATLYLAISLISFDMGDPSWSHSSPVVEDAANWGGLFGAYVADVGYYLFGWSFWWWIAAACVVLYKNFRLHAKQTENEAYNHKIAAAALFVLTVFSPVLEYFVLGGKYADSLPVGAGGMVGIRVGAVFAWLLGKSGSLLIILVVLLLSLSLLVQISWLEFLNGAGRAVQNRLSALSGKVMALRKRRPNTKTDGVDTQNTRRMVKEAKNITAKPVALPEGSSSNRKSVAVSVAPPPKIQPSLFEDNEVQQNGEYHKPTLNLLRIPDSEPVSINPAELERTAELIESKLAEFGIGVQVVSATSGPVITRYEIEPAQGVKGSQIVALSKDLARSMSLQSVRIVETIAGKNTMGIELPNDKRQDVMLSEILSSPVFAEAKSKLTVALGKDIAGTPVVGDLAKMPHLLVAGMTGSGKSVGVNGMIMSMLFKATPEEVRFIMIDPKMLELSIYDGIPHLLCPVVTDMREAGQALNWCVAEMEKRYRLLSHAGVRNLEGFNQKVEQAKAAGKPLLNPFSLNLDEPEPLEKLPMIVVVIDELADLMMTERKAVEQQIARLAQKARAAGIHMIVATQRPSVDVVTGLIKANIPTRMAFTVQSKIDSRTILDQMGADELLKYGDSLFLQPGSAEPTRLQGTFVSDGEVHQVVNYVKSQAPADYIEGLLSGEAALETANIVNPNADSDELFDQAVAYVLESKKTSISSLQRQLRIGYNRAANLMEALENAGIVSPSDFNGSRKILAHKDHL The sequence has been withdrawn from uniprot. pbp2_neigo Probable peptidoglycan D,D-transpeptidase PenA penA Penicillin-binding protein 2 protein protein neigo Neisseria gonorrhoeae MLIKSEYKPRMLPKEEQVKKPMTSNGRISFVLMAMAVLFACLIARGLYLQTVTYNFLKEQGDNRIVRTQALPATRGTVSDRNGAVLALSAPTESLFAVPKDMKEMPSAAQLERLSELVDVPVDVLRNKLEQKGKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDIDGKGQEGLELSLEDSLYGEDGAEVVLRDRQGNIVDSLDSPRNKAPQNGKDIILSLDQRIQTLAYEELNKAVEYHQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQRRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNERLNTQPYKIGPSPVRDTHVYPSLDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELGIGVRMHSGFPGETAGLLRNWRRWRPIEQATMSFGYGLQLSLLQLARAYTALTHDGVLLPLSFEKQAVAPQGKRIFKESTAREVRNLMVSVTEPGGTGTAGAVDGFDVGAKTGTARKFVNGRYADNKHVATFIGFAPAKNPRVIVAVTIDEPTAHGYYGGVVAGPPFKKIMGGSLNILGISPTKPLTAAAVKTPS ftsw-1 3519474 N/A 3519477 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell N/A 3519478 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false t4 ftsa-ftsz-7 3519474 N/A 3519479 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell binding region binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 3519480 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false t4 f4 ftsa-ftsq-2 3519474 N/A 3519479 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell binding region binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3519481 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false t4 f5 ftsa-ftsz-12 3519474 N/A 3519479 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell binding region binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false N/A 3519478 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false t4 f3 ftsz-ftsk_1-1 3519474 N/A 3519482 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell N/A 3519478 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false t4 ftsa-ftsk_1-1 3519474 N/A 3519482 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell N/A 3519479 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false t4 ftsa-ftsk_1-2 3519474 N/A 3519482 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell N/A 3519480 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false t4 ftsa-ftsw-1 3519474 N/A 3519477 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell N/A 3519479 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false t4 pena-ftsw-1 3519474 N/A 3519477 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell N/A 3519483 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false t4 ftsz-ftsz-16 3519474 N/A 3519478 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell N/A 3519478 unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false t4 f3 ftsa-ftsq-3 3519475 N/A 3519479 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) N/A 3519481 unspecified role unspecified role bait bait purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 3519475 f2c ftsq-ftsa-1 3519475 N/A 3519479 unspecified role unspecified role bait bait purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 3519478 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) physical association physical association false false false 3519475 f2a tpc-ftsa-1 3519475 N/A 3519479 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) N/A 3519480 unspecified role unspecified role bait bait purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false 3519475 f2e ftsq-ftsa-2 3519476 N/A 3519479 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3519481 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false f1a ftsa-tpc-1 3519476 N/A 3519479 unspecified role unspecified role prey prey purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3519480 unspecified role unspecified role bait bait purified purified GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false f1b