DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ andreeva-2017-1 ecoli Escherichia coli (strain K12) x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction structure determination identification by structure determination identification by structure determination structure determination Andreeva L., Hiller B., Kostrewa D., Lässig C., de Oliveira Mann CC., Jan Drexler D., Maiser A., Gaidt M., Leonhardt H., Hornung V., Hopfner KP. hopfner@genzentrum.Imu.de Nature 2017 imex curation Only protein-protein interactions imex curation andreeva-2017-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Andreeva L., Hiller B., Kostrewa D., Lässig C., de Oliveira Mann CC., Jan Drexler D., Maiser A., Gaidt M., Leonhardt H., Hornung V., Hopfner KP. hopfner@genzentrum.Imu.de Nature 2017 imex curation Only protein-protein interactions imex curation cgas_mouse Cyclic GMP-AMP synthase Cgas Mb21d1 Mab-21 domain-containing protein 1 2'3'-cGAMP synthase protein protein mouse Mus musculus Mouse MEDPRRRTTAPRAKKPSAKRAPTQPSRTRAHAESCGPQRGARSRRAERDGDTTEKPRAPGPRVHPARATELTKDAQPSAMDAAGATARPAVRVPQQQAILDPELPAVREPQPPADPEARKVVRGPSHRRGARSTGQPRAPRGSRKEPDKLKKVLDKLRLKRKDISEAAETVNKVVERLLRRMQKRESEFKGVEQLNTGSYYEHVKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFKRIPRGNPLSHFLEGEVLSATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNPEEISVDIILALESKGSWPISTKEGLPIQGWLGTKVRTNLRREPFYLVPKNAKDGNSFQGETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQELIDRKSKEFLSKKIEYERNNGFPIFDKL q00059-1 Transcription factor A, mitochondrial Mitochondrial transcription factor 1 Transcription factor 6 Transcription factor 6-like 2 TFAM TCF6 TCF6L2 protein protein human Homo sapiens Human MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC q8n884-1 Isoform 1 of Cyclic GMP-AMP synthase CGAS C6orf150 MB21D1 protein protein human Homo sapiens Human MQPWHGKAMQRASEAGATAPKASARNARGAPMDPTESPAAPEAALPKAGKFGPARKSGSRQKKSAPDTQERPPVRATGARAKKAPQRAQDTQPSDATSAPGAEGLEPPAAREPALSRAGSCRQRGARCSTKPRPPPGPWDVPSPGLPVSAPILVRRDAAPGASKLRAVLEKLKLSRDDISTAAGMVKGVVDHLLLRLKCDSAFRGVGLLNTGSYYEHVKISAPNEFDVMFKLEVPRIQLEEYSNTRAYYFVKFKRNPKENPLSQFLEGEILSASKMLSKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEKISVDITLALESKSSWPASTQEGLRIQNWLSAKVRKQLRLKPFYLVPKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF cgas-1 3466791 N/A 3466793 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 3466793 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 3466800 3466798 direct interaction direct interaction false false false Fig 1d-e, Table S3 cgas-tfam-1 3466792 N/A 3466794 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 3466795 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Flag tag Flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false HA tag HA tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Extended Data Fig 9e