IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ henning-2017-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation henning-2017-6 in vitro In vitro enzymatic study enzymatic study weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. RNA unwinding assay: Brr2 catalyzes the ATP-dependent unwinding of U4/U6 RNA duplices. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation henning-2017-7 in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation henning-2017-4 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation henning-2017-3 in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation henning-2017-5 in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay anti tag western anti tag western blot anti tag western Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation henning-2017-8 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation henning-2017-2 in vitro In vitro crosslink cross-linking study crosslink ms participant Identification by mass spectrometry ms participant Henning LM., Santos KF., Sticht J., Jehle S., Lee CT., Wittwer M., Urlaub H., Stelzl U., Wahl MC., Freund C. Cross linking agent:BS3 (bis(sulfosuccinimidyl)suberate): an amine-to-amine crosslinker FBP21 was determined to be of human origin based on mutation mapping. BRR2 was determined to be of human origin based on figure 1 PDB entry -4F91. U4/U6 snRNAs were determined to be of Yeast origin based on Ref. 21. (Santos et al.) Prp8Jab1_Delta_C was determined to be of Yeast origin based on mutation mapping from Ref.26. The exact sequence of this construct is not stated but based on pmid:24643059 possible construct details have been entered. ("yPrp8Jab1-A2399stop strongly enhanced the RNA binding, RNA-stimulated ATPase and U4/U6 unwinding activities of yBrr2") chfreund@zedat.fu-berlin.de,mwahl@zedat.fu-berlin.de Nucleic acids research 2017 Only protein-protein interactions imex curation imex curation wbp4_human WW domain-binding protein 4 WBP4 FBP21 FNBP21 Formin-binding protein 21 WW domain-containing-binding protein 4 protein protein human Homo sapiens Human MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEIKQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMADGVAPVFKKRRTENGKSRNLRQRGDDQ mint A spliceosome-associated protein; may play a role in cross-intron bridging of U1 and U2 snRNPs in the mammalian A complex u520_human U5 small nuclear ribonucleoprotein 200 kDa helicase SNRNP200 HELIC2 KIAA0788 U5 snRNP-specific 200 kDa protein Activating signal cointegrator 1 complex subunit 3-like 1 BRR2 homolog ASCC3L1 protein protein human Homo sapiens Human MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKTLNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLATYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIEMTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRPVPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPYLEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFLYRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLTDSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIKRLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD ppih_human Peptidyl-prolyl cis-trans isomerase H U-snRNP-associated cyclophilin SnuCyp-20 Small nuclear ribonucleoprotein particle-specific cyclophilin H PPIH CYP20 CYPH Rotamase H protein protein human Homo sapiens Human MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM sf3b2_human Splicing factor 3B subunit 2 SF3B2 SAP145 Pre-mRNA-splicing factor SF3b 145 kDa subunit Spliceosome-associated protein 145 protein protein human Homo sapiens Human MATEHPEPPKAELQLPPPPPPGHYGAWAAQELQAKLAEIGAPIQGNREELVERLQSYTRQTGIVLNRPVLRGEDGDKAAPPPMSAQLPGIPMPPPPLGLPPLQPPPPPPPPPPGLGLGFPMAHPPNLGPPPPLRVGEPVALSEEERLKLAQQQAALLMQQEERAKQQGDHSLKEHELLEQQKRAAVLLEQERQQEIAKMGTPVPRPPQDMGQIGVRTPLGPRVAAPVGPVGPTPTVLPMGAPVPRPRGPPPPPGDENREMDDPSVGPKIPQALEKILQLKESRQEEMNSQQEEEEMETDARSSLGQSASETEEDTVSVSKKEKNRKRRNRKKKKKPQRVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFKRIFEAFKLTDDVKKEKEKEPEKLDKLENSAAPKKKGFEEEHKDSDDDSSDDEQEKKPEAPKLSKKKLRRMNRFTVAELKQLVARPDVVEMHDVTAQDPKLLVHLKATRNSVPVPRHWCFKRKYLQGKRGIEKPPFELPDFIKRTGIQEMREALQEKEEQKTMKSKMREKVRPKMGKIDIDYQKLHDAFFKWQTKPKLTIHGDLYYEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF snw1_human SNW domain-containing protein 1 Nuclear protein SkiP Ski-interacting protein Nuclear receptor coactivator NCoA-62 SKIIP SKIP SNW1 protein protein human Homo sapiens Human MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE wdr83_human WD repeat domain-containing protein 83 WDR83 MORG1 Mitogen-activated protein kinase organizer 1 protein protein human Homo sapiens Human MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEVLDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRSRRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG mint homomint Molecular scaffold protein for various multimeric protein complexes. Acts as a module in the assembly of a multicomponent scaffold for the ERK pathway, linking ERK responses to specific agonists. At low concentrations it enhances ERK activation, whereas high concentrations lead to the inhibition of ERK activation. Also involved in response to hypoxia by acting as a negative regulator of HIF1A/HIF-1-alpha via its interaction with EGLN3/PHD3. May promote degradation of HIF1A. May act by recruiting signaling complexes to a specific upstream activator (By similarity). May also be involved in pre-mRNA splicing zc21a_human Zinc finger C2HC domain-containing protein 1A ZC2HC1A C8orf70 FAM164A CGI-62 protein protein human Homo sapiens Human MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL fa50b_human Protein FAM50B Protein XAP-5-like FAM50B X5L protein protein human Homo sapiens Human MAQYKGTMREAGRAMHLLKKRERQREQMEVLKQRIAEETILKSQVDKRFSAHYDAVEAELKSSTVGLVTLNDMKARQEALVRERERQLAKRQHLEEQRLQQERQREQEQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAQREKVKDEEMEVTFSYWDGSGHRRTVRVRKGNTVQQFLKKALQGLRKDFLELRSAGVEQLMFIKEDLILPHYHTFYDFIIARARGKSGPLFSFDVHDDVRLLSDATMEKDESHAGKVVLRSWYEKNKHIFPASRWEAYDPEKKWDKYTIR tia1_human Nucleolysin TIA-1 isoform p40 TIA1 p40-TIA-1 RNA-binding protein TIA-1 T-cell-restricted intracellular antigen-1 protein protein human Homo sapiens Human MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQIMEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQIGYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGVQPPQGQNGSMLPNQPSGYRVAGYETQ argl1_human Arginine and glutamate-rich protein 1 ARGLU1 protein protein human Homo sapiens Human MGRSRSRSSSRSKHTKSSKHNKKRSRSRSRSRDKERVRKRSKSRESKRNRRRESRSRSRSTNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKRIMEKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNRKIAEAQAKLAEEQLRIVEEQRKIHEERMKLEQERQRQQKEEQKIILGKGKSRPKLSFSLKTQD hnrpk_human Heterogeneous nuclear ribonucleoprotein K HNRNPK HNRPK Transformation up-regulated nuclear protein protein protein human Homo sapiens Human METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF isy1_human Pre-mRNA-splicing factor ISY1 homolog ISY1 KIAA1160 protein protein human Homo sapiens Human MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRIRDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEPLPPPRKTRAELMKAIDFEYYGYLDEDDGVIVPLEQEYEKKLRAELVEKWKAEREARLARGEKEEEEEEEEEINIYAVTEEESDEEGSQEKGGDDSQQKFIAHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEEARRLLGY wbp11_human WW domain-binding protein 11 SH3 domain-binding protein SNP70 Npw38-binding protein WBP11 NPWBP SNP70 SIPP1 Splicing factor that interacts with PQBP-1 and PP1 protein protein human Homo sapiens Human MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQLSQYFDAVKNAQHVEVESIPLPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPTRAVSILPLLGHGVPRLPPGRKPPGPPPGPPPPQVVQMYGRKVGFALDLPPRRRDEDMLYSPELAQRGHDDDVSSTSEDDGYPEDMDQDKHDDSTDDSDTDKSDGESDGDEFVHRDNGERDNNEEKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVEEFSEDDDEDDSDDSEAEKQSQKQHKEESHSDGTSTASSQQQAPPQSVPPSQIQAPPMPGPPPLGPPPAPPLRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPPGPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPPNLIQRPKADDTSAATIEKKATATISAKPQITNPKAEITRFVPTALRVRRENKGATAAPQRKSEDDSAVPLAKAAPKSGPSVPVSVQTKDDVYEAFMKEMEGLL sf3a1_human Splicing factor 3A subunit 1 Spliceosome-associated protein 114 SF3a120 SF3A1 SAP114 protein protein human Homo sapiens Human MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSDDEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDTKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRPPMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAPVPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKERGGRKK prp16_human Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 DHX38 DDX38 KIAA0224 PRP16 ATP-dependent RNA helicase DHX38 DEAH box protein 38 protein protein human Homo sapiens Human MGDTSEDASIHRLEGTDLDCQVGGLICKSKSAASEQHVFKAPAPRPSLLGLDLLASLKRREREEKDDGEDKKKSKVSSYKDWEESKDDQKDAEEEGGDQAGQNIRKDRHYRSARVETPSHPGGVSEEFWERSRQRERERREHGVYASSKEEKDWKKEKSRDRDYDRKRDRDERDRSRHSSRSERDGGSERSSRRNEPESPRHRPKDAATPSRSTWEEEDSGYGSSRRSQWESPSPTPSYRDSERSHRLSTRDRDRSVRGKYSDDTPLPTPSYKYNEWADDRRHLGSTPRLSRGRGRREEGEEGISFDTEEERQQWEDDQRQADRDWYMMDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPEPVIPVKDATSDLAIIARKGSQTVRKHREQKERKKAQHKHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSEASSEFAKKKSILEQRQYLPIFAVQQELLTIIRDNSIVIVVGETGSGKTTQLTQYLHEDGYTDYGMIGCTQPRRVAAMSVAKRVSEEMGGNLGEEVGYAIRFEDCTSENTLIKYMTDGILLRESLREADLDHYSAIIMDEAHERSLNTDVLFGLLREVVARRSDLKLIVTSATMDAEKFAAFFGNVPIFHIPGRTFPVDILFSKTPQEDYVEAAVKQSLQVHLSGAPGDILIFMPGQEDIEVTSDQIVEHLEELENAPALAVLPIYSQLPSDLQAKIFQKAPDGVRKCIVATNIAETSLTVDGIMFVIDSGYCKLKVFNPRIGMDALQIYPISQANANQRSGRAGRTGPGQCFRLYTQSAYKNELLTTTVPEIQRTNLANVVLLLKSLGVQDLLQFHFMDPPPEDNMLNSMYQLWILGALDNTGGLTSTGRLMVEFPLDPALSKMLIVSCDMGCSSEILLIVSMLSVPAIFYRPKGREEESDQIREKFAVPESDHLTYLNVYLQWKNNNYSTIWCNDHFIHAKAMRKVREVRAQLKDIMVQQRMSLASCGTDWDIVRKCICAAYFHQAAKLKGIGEYVNIRTGMPCHLHPTSSLFGMGYTPDYIVYHELVMTTKEYMQCVTAVDGEWLAELGPMFYSVKQAGKSRQENRRRAKEEASAMEEEMALAEEQLRARRQEQEKRSPLGSVRSTKIYTPGRKEQGEPMTPRRTPARFGL dhx15_human Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 DHX15 DBP1 DDX15 DEAH box protein 15 ATP-dependent RNA helicase #46 protein protein human Homo sapiens Human MSKRHRLDLGEDYPSGKKRAGTDGKDRDRDRDREDRSKDRDRERDRGDREREREKEKEKELRASTNAMLISAGLPPLKASHSAHSTHSAHSTHSTHSAHSTHAGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMSVAQRVADEMDVMLGQEVGYSIRFEDCSSAKTILKYMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKFQIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRIFEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYPEILRSNLGSVVLQLKKLGIDDLVHFDFMDPPAPETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLSVPQCFVRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQNHESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPEWLVKIAPQYYDMSNFPQCEAKRQLDRIIAKLQSKEYSQY u6_snrna snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast u4_snrna snrna small nuclear rna snRNA snrna yeast Saccharomyces cerevisiae Baker's yeast prp8_yeast Pre-mRNA-splicing factor 8 PRP8 DBF3 DNA39 RNA8 SLT21 USA2 YHR165C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGLPPPPPGFEEDSDLALPPPPPPPPGYEIEELDNPMVPSSVNEDTFLPPPPPPPSNFEINAEEIVDFTLPPPPPPPGLDELETKAEKKVELHGKRKLDIGKDTFVTRKSRKRAKKMTKKAKRSNLYTPKAEMPPEHLRKIINTHSDMASKMYNTDKKAFLGALKYLPHAILKLLENMPHPWEQAKEVKVLYHTSGAITFVNETPRVIEPVYTAQWSATWIAMRREKRDRTHFKRMRFPPFDDDEPPLSYEQHIENIEPLDPINLPLDSQDDEYVKDWLYDSRPLEEDSKKVNGTSYKKWSFDLPEMSNLYRLSTPLRDEVTDKNYYYLFDKKSFFNGKALNNAIPGGPKFEPLYPREEEEDYNEFNSIDRVIFRVPIRSEYKVAFPHLYNSRPRSVRIPWYNNPVSCIIQNDEEYDTPALFFDPSLNPIPHFIDNNSSLNVSNTKENGDFTLPEDFAPLLAEEEELILPNTKDAMSLYHSPFPFNRTKGKMVRAQDVALAKKWFLQHPDEEYPVKVKVSYQKLLKNYVLNELHPTLPTNHNKTKLLKSLKNTKYFQQTTIDWVEAGLQLCRQGHNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRLGNSFHLMRELLKMMKLIVDTHVQFRLGNVDAFQLADGIHYILNHIGQLTGIYRYKYKVMHQIRACKDLKHIIYYKFNKNLGKGPGCGFWQPAWRVWLNFLRGTIPLLERYIGNLITRQFEGRSNEIVKTTTKQRLDAYYDLELRNSVMDDILEMMPESIRQKKARTILQHLSEAWRCWKANIPWDVPGMPAPIKKIIERYIKSKADAWVSAAHYNRERIKRGAHVEKTMVKKNLGRLTRLWIKNEQERQRQIQKNGPEITPEEATTIFSVMVEWLESRSFSPIPFPPLTYKNDTKILVLALEDLKDVYASKVRLNASEREELALIEEAYDNPHDTLNRIKKYLLTQRVFKPVDITMMENYQNISPVYSVDPLEKITDAYLDQYLWYEADQRKLFPNWIKPSDSEIPPLLVYKWTQGINNLSEIWDVSRGQSAVLLETTLGEMAEKIDFTLLNRLLRLIVDPNIADYITAKNNVVINFKDMSHVNKYGLIRGLKFASFIFQYYGLVIDLLLLGQERATDLAGPANNPNEFMQFKSKEVEKAHPIRLYTRYLDRIYMLFHFEEDEGEELTDEYLAENPDPNFENSIGYNNRKCWPKDSRMRLIRQDVNLGRAVFWEIQSRVPTSLTSIKWENAFVSVYSKNNPNLLFSMCGFEVRILPRQRMEEVVSNDEGVWDLVDERTKQRTAKAYLKVSEEEIKKFDSRIRGILMASGSTTFTKVAAKWNTSLISLFTYFREAIVATEPLLDILVKGETRIQNRVKLGLNSKMPTRFPPAVFYTPKELGGLGMISASHILIPASDLSWSKQTDTGITHFRAGMTHEDEKLIPTIFRYITTWENEFLDSQRVWAEYATKRQEAIQQNRRLAFEELEGSWDRGIPRISTLFQRDRHTLAYDRGHRIRREFKQYSLERNSPFWWTNSHHDGKLWNLNAYRTDVIQALGGIETILEHTLFKGTGFNSWEGLFWEKASGFEDSMQFKKLTHAQRTGLSQIPNRRFTLWWSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESIVFDICQILDGELDVLQIESVTKETVHPRKSYKMNSSAADITMESVHEWEVSKPSLLHETNDSFKGLITNKMWFDVQLRYGDYDSHDISRYVRAKFLDYTTDNVSMYPSPTGVMIGIDLAYNMYDAYGNWFNGLKPLIQNSMRTIMKANPALYVLRERIRKGLQIYQSSVQEPFLNSSNYAELFNNDIKLFVDDTNVYRVTVHKTFEGNVATKAINGCIFTLNPKTGHLFLKIIHTSVWAGQKRLSQLAKWKTAEEVSALVRSLPKEEQPKQIIVTRKAMLDPLEVHMLDFPNIAIRPTELRLPFSAAMSIDKLSDVVMKATEPQMVLFNIYDDWLDRISSYTAFSRLTLLLRALKTNEESAKMILLSDPTITIKSYHLWPSFTDEQWITIESQMRDLILTEYGRKYNVNISALTQTEIKDIILGQNIKAPSVKRQKMAELEAARSEKQNDEEAAGASTVMKTKTINAQGEEIVVVASADYESQTFSSKNEWRKSAIANTLLYLRLKNIYVSADDFVEEQNVYVLPKNLLKKFIEISDVKIQVAAFIYGMSAKDHPKVKEIKTVVLVPQLGHVGSVQISNIPDIGDLPDTEGLELLGWIHTQTEELKFMAASEVATHSKLFADKKRDCIDISIFSTPGSVSLSAYNLTDEGYQWGEENKDIMNVLSEGFEPTFSTHAQLLLSDRITGNFIIPSGNVWNYTFMGTAFNQEGDYNFKYGIPLEFYNEMHRPVHFLQFSELAGDEELEAEQIDVFS 8F4F6F89D34D3508 p14678-2 Small nuclear ribonucleoprotein-associated proteins B and B' SNRPB COD SNRPB1 Sm protein B/B' protein protein human Homo sapiens Human MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGLL 124436taqetrtu-1 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false N/A 3358119 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-1 wbp4-snrnp200-2 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3358120 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-3 MORG1, SKIP, PPIH, FAM164A and FAM50B interacted only with full length constructs of FBP21. wbp4-ppih-1 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3358121 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-4 wbp4-sf3b2-1 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3358122 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-5 MORG1, SKIP, PPIH, FAM164A and FAM50B interacted only with full length constructs of FBP21. wbp4-snw1-1 3358110 N/A 3358123 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1-6 MORG1, SKIP, PPIH, FAM164A and FAM50B interacted only with full length constructs of FBP21. wbp4-wdr83-1 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false N/A 3358124 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-7 MORG1, SKIP, PPIH, FAM164A and FAM50B interacted only with full length constructs of FBP21. wbp4-zc2hc1a-1 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false O75554:p.Trp150Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false N/A 3358125 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-8 MORG1, SKIP, PPIH, FAM164A and FAM50B interacted only with full length constructs of FBP21. wbp4-fam50b-1 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3358126 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-9 wbp4-tia1-1 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3358127 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-10 wbp4-zc2hc1a-2 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3358128 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-11 wbp4-hnrnpk-1 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3358129 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-12 wbp4-isy1-1 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3358130 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-13 wbp4-wbp11-1 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3358131 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-14 wbp4-sf3a1-1 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3358132 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-15 wbp4-dhx38-1 3358110 N/A 3358118 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed O75554:p.Trp191Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false N/A 3358133 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association false false false Table 1-16 1234345qw3rwety-1 3358111 N/A 3358134 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro N/A 3358135 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3358119 enzyme enzyme neutral component neutral component purified purified nc_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. atpase reaction atpase reaction false false false Figure 4A The unwinding activity of full length and Brr2NC was unchanged upon addition of FBP21 200–376. snrnp200-u4_snrna-1 3358111 N/A 3358134 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro N/A 3358135 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3358119 enzyme enzyme neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. atpase reaction atpase reaction false false false Figure 4A-2 snrnp200-u4_snrna-2 3358111 N/A 3358118 inhibitor inhibitor neutral component neutral component purified purified c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3358134 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro N/A 3358135 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3358119 enzyme enzyme neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. atpase reaction atpase reaction false false false Figure 4A-3, 4D, supp fig 10-A FBP21 200–376 caused the apparent unwinding rate of Brr2_HR to be reduced nearly by half. snrnp200-u4_snrna-7 3358111 N/A 3358118 inhibitor inhibitor neutral component neutral component purified purified c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3358134 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro N/A 3358135 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3358119 enzyme enzyme neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. atpase reaction atpase reaction false false false Figure 4E/F, supp fig 10-B FBP21 276–376 reduced the unwinding rate of Brr2-HR approximately two-fold, similar to FBP21 200–376. However, experiments employing high concentrations of FBP21 276–376 revealed the same reduction in unwinding rate, but no decrease in the unwound fraction. FBP21 326–376 has no inhibitory effect on Brr2-HR snrnp200-u4_snrna-8 3358111 N/A 3358136 stimulator stimulator neutral component neutral component purified purified Jab1_deltaC_construct sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 3358134 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro N/A 3358135 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3358119 enzyme enzyme neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. atpase reaction atpase reaction false false false Figure 4G-1 prp8-snrnp200-1 3358111 N/A 3358118 inhibitor inhibitor neutral component neutral component purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3358136 stimulator stimulator neutral component neutral component purified purified Jab1_deltaC_construct sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 3358134 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro N/A 3358135 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3358119 enzyme enzyme neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. atpase reaction atpase reaction false false false Figure 4G-2 The activatory effect of Prp8Jab1_delta_C is completely abolished in presence of FBP21_200–376. snrnp200-u4_snrna-9 3358111 N/A 3358118 inhibitor inhibitor neutral component neutral component purified purified c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3358119 enzyme enzyme neutral component neutral component purified purified c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3358134 enzyme target enzyme target substrate substrate neutral component neutral component purified purified in vitro In vitro N/A 3358135 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro atpase reaction atpase reaction false false false Supp fig 11 G/H FBP21_116–376 inhibited the Brr2HR helicase activity to a similar extent as FBP21_200–376. snrnp200-u4_snrna-3 3358112 N/A 3358118 unspecified role unspecified role neutral component neutral component purified purified region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3358134 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3358135 unspecified role unspecified role neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false 3358112 Figure 4B, Supp fig 9. u4_snrna-u6_snrna-1 3358112 N/A 3358118 unspecified role unspecified role neutral component neutral component purified purified region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3358135 unspecified role unspecified role neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro direct interaction direct interaction false false false 3358112 Figure 4B, Supp fig 9.-2 snrnp200-u4_snrna-4 3358112 N/A 3358118 inhibitor inhibitor neutral component neutral component purified purified c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3358134 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3358135 unspecified role unspecified role neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3358119 unspecified role unspecified role neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association false false false 3358112 Figure 4C-2 FBP21 200–376 inhibits RNA binding of Brr2HR when present in high concentrations. Inhibition is reduced when the shorter FBP21 276–376 is used. Kd given for the interaction in the presence of 5uM FBP21 200-376 (163nM). When the shorter FBP21 276–376 was used, a Kd of 43nM was obtained. snrnp200-u4_snrna-5 3358112 N/A 3358134 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3358135 unspecified role unspecified role neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3358119 unspecified role unspecified role neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association false false false 3358112 Figure 4C-1 snrnp200-u4_snrna-6 3358112 N/A 3358118 inhibitor inhibitor neutral component neutral component purified purified c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3358134 unspecified role unspecified role neutral component neutral component purified purified in vitro In vitro N/A 3358135 unspecified role unspecified role neutral component neutral component purified purified 5_prime 32p radiolabel 32p radiolabel P32 32P 32P P32 certain certain sequence position certain certain certain sequence position certain false in vitro In vitro N/A 3358119 unspecified role unspecified role neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association false false false 3358112 Figure 4C-3 FBP21 200–376 inhibits RNA binding of Brr2HR when present in high concentrations. Inhibition is reduced when the shorter FBP21 276–376 is used. Kd for the interaction in the presence of 5uM FBP21 200-376 was 163nM. When the shorter FBP21 276–376 was used, a Kd of 43nM was obtained. snrnp200-wbp4-2 3358113 N/A 3358118 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3358119 unspecified role unspecified role neutral component neutral component purified purified c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 1.0 direct interaction direct interaction false false false Figure 3A, Supp 11 A/C/D Kd values obtained for the interaction of FBP21_116–376 with Brr2 in both presence and absence of SmB-peptide were similar. snrnp200-wbp4-4 3358113 N/A 3358118 unspecified role unspecified role neutral component neutral component purified purified O75554:p.[Lys357Glu;Arg359Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O75554:p.[Lys358Ala;Arg360Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3358119 unspecified role unspecified role neutral component neutral component purified purified c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 1.0 direct interaction direct interaction false false false Figure 3A-3 snrnp200-wbp4-8 3358113 N/A 3358118 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region_peptide57 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminal_region_peptide58 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminal_peptide_fkkrr sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O75554:p.Phe356_Arg360delinsLysArgPheArgLys mutation mutation certain certain sequence position certain certain certain sequence position certain false O75554:p.Phe356_Arg360delinsGlyLysLysArgArg mutation mutation certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 N/A 3358119 unspecified role unspecified role neutral component neutral component purified purified c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. Stoichiometry: 1.0 direct interaction direct interaction false false false Supp. Fig 6, Fig. 3A The mutated peptides GKKRR and KRFRK give a Kd of 37 and 27 uM respectively. snrnp200-wbp4-9 3358113 N/A 3358118 unspecified role unspecified role neutral component neutral component purified purified c-terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3358137 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 3358113 Supp Fig 11 B/D/EF Brr2C-Sec63 itself did not interact with the SmB-peptide. The Kd values obtained in both presence and absence of Brr2C-Sec63 were similar. wbp4-snrnp200-3 3358114 N/A 3358118 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3358119 unspecified role unspecified role neutral component neutral component purified purified c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction false false false Figure 2A snrnp200-wbp4-1 3358114 N/A 3358118 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false O75554:p.[Lys357Glu;Arg359Glu] mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3358119 unspecified role unspecified role neutral component neutral component purified purified c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction false false false Figure 2B, 3C, Supp. figure 2/3/4 Binding of FBP21_276-376 and FBP21_326-376 induced similar chemical shift changes. snrnp200-wbp4-3 3358114 N/A 3358118 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region_peptide57 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminal_region_peptide58 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3358119 unspecified role unspecified role neutral component neutral component purified purified region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false c-sec63 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction false false false Figure 3C, Supp.Fig 7 Binding of peptide 58 to Brr2C-Sec63 induced chemical shift changes that were intermediate between peptide 57 and FBP21276–376 in number and magnitude. snrnp200-wbp4-5 3358115 N/A 3358118 unspecified role unspecified role prey prey purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3358119 unspecified role unspecified role bait bait purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false CC_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction false false false Figure 3B Full length Brr2 reacted weakly. snrnp200-wbp4-6 3358115 N/A 3358118 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3358119 unspecified role unspecified role bait bait purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false CC_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction false false false Figure 3B-2 1346-1 3358116 N/A 3358118 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3358119 unspecified role unspecified role neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false CC_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. direct interaction direct interaction false false false Supp figure 1A-E snrnp200-wbp4-7 3358116 N/A 3358118 unspecified role unspecified role neutral component neutral component purified purified c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3358136 unspecified role unspecified role neutral component neutral component purified purified Jab1_deltaC_construct sufficient to bind sufficient binding region sufficient to bind range range range range false N/A 3358119 unspecified role unspecified role neutral component neutral component purified purified HR_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association false false false Supp figure 1F/G Size exclusion chromatography revealed that FBP21_276–376 can bind simultaneously with Prp8Jab1_delta_C to Brr2-HR. wbp4-snrnp200-1 3358117 N/A 3358118 unspecified role unspecified role neutral component neutral component purified purified lys338 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false c_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false lys286 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys274 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys284 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys286 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys338 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys250 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys270 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys274 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys284 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys286 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys338 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys365 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys338 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3358119 unspecified role unspecified role neutral component neutral component purified purified lys1874 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys1874 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys1874 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys1874 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys107 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys1567 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys1603 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys1711 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys1841 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys1874 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys2080 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys2087 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys1567 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false lys1567 cross linker cross linker crosslinker crosslinker certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 3358392 3358376 3358393 3358381 3358394 3358380 3358395 3358379 3358396 3358383 3358397 3358386 3358398 3358390 3358399 3358385 3358400 3358378 3358401 3358384 3358402 3358382 3358403 3358389 3358404 3358387 3358405 3358388 physical association physical association false false false Figure 1 The cross-link between FBP21 K338 and Brr2 K1874 was the predominant site.