UniProt UniProt http://www.uniprot.org chen-2017-4 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen C., Itakura E., Nelson GM., Sheng M., Laurent P., Fenk LA., Butcher RA., Hegde RS., de Bono M. debono@mrc-lmb.cam.ac.uk Nature 2017 Only protein-protein interactions imex curation imex curation chen-2017-5 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging anti-tag immunocytochemistry anti-tag immunocytochemistry Chen C., Itakura E., Nelson GM., Sheng M., Laurent P., Fenk LA., Butcher RA., Hegde RS., de Bono M. debono@mrc-lmb.cam.ac.uk Nature 2017 Only protein-protein interactions imex curation imex curation chen-2017-6 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. comigration in sds comigration in sds page comigration in sds anti tag western anti tag western blot anti tag western Chen C., Itakura E., Nelson GM., Sheng M., Laurent P., Fenk LA., Butcher RA., Hegde RS., de Bono M. debono@mrc-lmb.cam.ac.uk Nature 2017 Only protein-protein interactions imex curation imex curation ilcr1_caeel Interleukin cytokine receptor-related protein 1 Interleukin-17 receptor-like protein 1 Y64G10A.6 ilcr-1 protein protein caeel Caenorhabditis elegans MFLHSPALLIWLFLFCLAGPQAVRTEPYNSTSSSSSPTANDVTSSDLLLLASEETPTRAPKPVTKQGKKNVVKVKKGGNGTVDDSPWVTDCSEPLNKDISCSVNIIGCSDNVFKYVDAGQEPPRAHDVRIAPTTKVMGANRIDKRKHRLHVDVSWQIPQLEASTHLKAFKLIVNGPDGKNTCFVFNVTQTHVDDEGISPRYRFSSNTLFDFGHNYTVTIVSLPMSRKRAPKVSATSLMPDDPDAAPVKIVKTNEQMCEGKSNPQASKWAASFRKIFLFSAIRLIQIEFLAAPPQYCFEEYEVRLLDSSGIVMLQSAIITKDELRTEIINGRPVQFGEFNFTDIELDTDLIPSVIPIESAHDGRCLCVTENGCSCLAADWKPVKLTRIEKPPATSNQTEESDGKAEKDKKEDTTWTWHTYAITGGAIIAILFILSVCAGLKCYKKFNNKKKASNIHLLNENPAFSHSGSIPLILKQSISVLIVYSHDSAQHEAAVLAFAELLRDVFNLNVHLDVWDEDDIEENRAEYINSSIVRANKVIIINSIGAYFRTVFRHQREPAIERITTGRNDVIFDMQCELALQHPCVISCHFSYTNPKYVFFPINRLLQYSIPNSLMTMTTALTEQPARPEQLAGFNQVFARLQAAISRKLNYIESDPQWFENTHHRVATRRVSELEAHNIVPLPPSLEVKVEDEDAFGQMETLPIDELKEKFAAKRDLEVEVLDSEDVKLLEDVKCAPGPIHVEPTEPEVLEPAEEPMEEAEEDEEDEDDVDSVEGQTARIEELQRLIVHKDMNHDSGNLDSAYVSGSDFSADIHNEILDKPRLNAEMDLRKANREDSAFHDEVIGIH ilcr2_caeel Interleukin cytokine receptor-related protein 2 ilcr-2 Interleukin-17 receptor-like protein 2 F56D1.2 protein protein caeel Caenorhabditis elegans MVRLCTTNFLAYRATGSPLLLLYFYLCSLSSVKSSAAASYTNASDYVLRNVFEHSDQCYKDSFVYVRADDKKSDPFITYSTTKECSERLKKNDLPEKLPTCPPGLIDLELKPVYVPKSQISYPYANLNISVTAHSSVDTIAFRLECLSASDGSDVYCSNSKAMYINGVKEWPCRGIHLSSRVQYPTRFSYSCFRLTSFSVYAINATILPQKCRVSTIMTAPYFDDMFPEILVDPTTNQSIITKTDPFWAPMLSADFSDKNAIWVRLGKAERAECETMVVNVYKEHDDDSQKVTFLEILTVKCPETAVKWENQKAGRYLLTAYVPIRGCKFYCEKKERGCRQCLRTHLNLVIYKNRASLSWLALQKFKDYGFEIFIAVVVLLILIIVLAVTGFGYVLWRDKVRSREVRNIALTEFVKVMIVYADDNDLHTDCVKKLVENLRNCASCDPVFDLEKLITAEQIVPSRWLVDQISSLKKFIIVVSDCAEKILDTEASETHQLVQARPFADLFGPAMEMIIRDATHNFPEARKKYAVVRFNYSPHVPPNLAILNLPTFILPEQFAQLTAFLHNVEHTERANVTQNISEAQIHEWNLCASRMMSFFVRNPNWLETRWKPKDELAALHLKRQSPVIVPIQTEEDRIAASIKYNLVPPQALVDSDDEDDVDLQPHASHQNQPLILLPPEQCGPDSDSDSESDSSSESESESDNEGEDPKTIVVKKS actl1_caeel ACT1-like protein actl-1 C15B12.6 protein protein caeel Caenorhabditis elegans MTKMKMDVTIELDLDGDDWEEVDVLSDKCVEDILEDVHIDDPILVSDVRITLPANIRIKNFKKEIRDLILANLDVPTTVSAGSWQIVSSFLRGIEYSEIGGRERNSKLSWKPFEDMHAQILVNALAYAQRVDILVKLKSYIDSNSYLKNVPEPMFAFADTDSMASTTTFSEYAEPVHSMNARKKILLLHYETTSKEKEDFKWFKCNLKNVLEKERKEGKDLEVFDVKVWEKDDRGNVFQELEKHYDLFPHIVVCFNKSYIEATKPNSKSKMPQFRKSISDKLNVEFHMNGNRNLRGRCVLMSEVEKVTDTYWAAVTNQYPFPGSFEPFVKRLLRDGKVKKQSHNNANDHHEDSMNYSITQ pik1_caeel Pelle-like serine/threonine-protein kinase pik-1 pik-1 K09B11.1 protein protein caeel Caenorhabditis elegans MDDSLGVSEVVMIPFMKREVLQQICAILDTDNTWETIAPYMPGIELRDVEGCKRYSSYNQSPSELLLRIWSSKGYSTTHLYQLFAKTKLIRLMRMMRSQVHEKYHYLENKVTNSTSRVSKQMVQPPGSQSASRLKKTEIKESSPSPAAAAASQLSRSNTDDTLRVAIEGTLPVTYCELLEATNGFAVSNVIGKGGYGTVYKGELKGTGGIVAVKRLHSGNDTSQNGSRERLRQSLTELRTLARFRHDNILPIYAYSLEGSEPCLVYQFMSNGSLEDRLLCRKGSVPLTWIQRKEISIGAGRGLGFLHSFGKTPIIHGDIKTANILLDKHMEPKIGDFGLCRDGHVEAEAMEKHPLIASHIKGTLAYLAPEFITSKILTTKLDVYSFGIVLLEIASGQRAYSDSRETRGLVEYCQVNKELAAHRKIPVREIFIDRRAPPLVGDEEKSFLDALIEVGLAGANNDRKVRPTMSQIVEYLCKNSIPPVV il171_caeel Interleukin cytokine-related protein 17.1 Interleukin 17 cytokine-related protein 1 T22H6.1 ilc-17.1 protein protein caeel Caenorhabditis elegans MPKSPHRTNLQSFYPIMIILTHLALDSNCWRIRREVDGEEEDIMPSEECYHKYNEENHFKVFSNYLNRKNSSHYSPIAPSYQQALLRLQVKGLKHGEQITKSSGKCNSKKLDTISAETPLRDRALCKFEYVLNYNPKRLPAALTEVKCSCPRPNSKLVGKRIFECEHLRYQVRVLMWDDSCNTFREHVETIALACIPVIQANANADGDDDFIYTIKAEIPI ilcr_1-yso2_caeel-1 3357442 N/A 3357445 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3357446 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1C yso2_caeel-ilcr_1-1 3357442 N/A 3357445 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3357446 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1C ilcr_1-actl_1-1 3357442 N/A 3357446 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3357447 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5A actl_1-yso2_caeel-1 3357442 N/A 3357446 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3357447 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5B actl_1-pik_1-1 3357442 N/A 3357448 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3357447 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5D pik_1-actl_1-1 3357442 N/A 3357448 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 3357447 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5C ilcr_1-actl_1-2 3357442 N/A 3357445 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3357447 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5A actl_1-ilcr_1-1 3357442 N/A 3357445 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3357447 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5B ilcr_1-yso2_caeel-2 3357443 N/A 3357445 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3357446 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 1B ilc_17.1-1 3357444 N/A 3357449 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed purified purified n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Stoichiometry: 2.0 direct interaction direct interaction false false false Extended Fig. 1H In the presence of 100mM dithiothreotol, the protein becomes monomeric, suggesting ILC-17.1 forms disulfide-linked dimers.