UniProt UniProt http://www.uniprot.org cheng-2016-10 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cheng YM., Tsai CC., Hsu YC. chengym@mail.ncku.edu.tw, d8702008@tmu.edu.tw, jenway@mail.cjcu.edu.tw International journal of molecular sciences 2016 Only protein-protein interactions imex curation imex curation cdk1_human Cyclin-dependent kinase 1 p34 protein kinase Cell division protein kinase 1 CDK1 CDC2 Cell division control protein 2 homolog CDC28A CDKN1 P34CDC2 protein protein human Homo sapiens Human MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM ga45b_human Growth arrest and DNA damage-inducible protein GADD45 beta Myeloid differentiation primary response protein MyD118 Negative growth regulatory protein MyD118 GADD45B MYD118 protein protein human Homo sapiens Human MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER ccnb1_human G2/mitotic-specific cyclin-B1 CCNB1 CCNB protein protein human Homo sapiens Human MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV cdk1-gadd45b-1 3338163 N/A 3338164 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3338165 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous physical association physical association false false false Fig. 6A, 6B Sulforaphane (CHEBI:47807) increases the amount of complex formed, but this appears to be due to an increase in GADD45B levels rather than acting as an agonist of complex formation ccnb1-cdk1-6 3338163 N/A 3338166 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3338164 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous physical association physical association false false false Fig. 6A, 6B Sulforaphane (CHEBI:47807) decreases the amount of complex formed, but this appears to be due to an decrease in Cyclin B1 levels rather than acting as an antagonist of complex formation