DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wilson-2016-7 in vitro In vitro bio-layer interferometry bio-layer interferometry bli bli experimental particp experimental participant identification experimental particp Wilson MD., Benlekbir S., Fradet-Turcotte A., Sherker A., Julien JP., McEwan A., Noordermeer SM., Sicheri F., Rubinstein JL., Durocher D. sicheri@lunenfeld.ca, john.rubinstein@ utoronto.ca, durocher@lunenfeld.ca, Nature 2016 Only protein-protein interactions imex curation imex curation wilson-2016-3 in vitro In vitro pull down pull down experimental particp experimental participant identification experimental particp Wilson MD., Benlekbir S., Fradet-Turcotte A., Sherker A., Julien JP., McEwan A., Noordermeer SM., Sicheri F., Rubinstein JL., Durocher D. sicheri@lunenfeld.ca, john.rubinstein@ utoronto.ca, durocher@lunenfeld.ca, Nature 2016 Only protein-protein interactions imex curation imex curation wilson-2016-5 in vitro In vitro crosslink cross-linking study crosslink experimental particp experimental participant identification experimental particp Wilson MD., Benlekbir S., Fradet-Turcotte A., Sherker A., Julien JP., McEwan A., Noordermeer SM., Sicheri F., Rubinstein JL., Durocher D. sicheri@lunenfeld.ca, john.rubinstein@ utoronto.ca, durocher@lunenfeld.ca, Nature 2016 Only protein-protein interactions imex curation imex curation wilson-2016-1 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog experimental particp experimental participant identification experimental particp Wilson MD., Benlekbir S., Fradet-Turcotte A., Sherker A., Julien JP., McEwan A., Noordermeer SM., Sicheri F., Rubinstein JL., Durocher D. sicheri@lunenfeld.ca, john.rubinstein@ utoronto.ca, durocher@lunenfeld.ca, Nature 2016 Only protein-protein interactions imex curation imex curation wilson-2016-2 in vitro In vitro light scattering light scattering experimental particp experimental participant identification experimental particp Wilson MD., Benlekbir S., Fradet-Turcotte A., Sherker A., Julien JP., McEwan A., Noordermeer SM., Sicheri F., Rubinstein JL., Durocher D. sicheri@lunenfeld.ca, john.rubinstein@ utoronto.ca, durocher@lunenfeld.ca, Nature 2016 Only protein-protein interactions imex curation imex curation wilson-2016-4 in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column experimental particp experimental participant identification experimental particp Wilson MD., Benlekbir S., Fradet-Turcotte A., Sherker A., Julien JP., McEwan A., Noordermeer SM., Sicheri F., Rubinstein JL., Durocher D. sicheri@lunenfeld.ca, john.rubinstein@ utoronto.ca, durocher@lunenfeld.ca, Nature 2016 Only protein-protein interactions imex curation imex curation wilson-2016-6 in vitro In vitro itc isothermal titration calorimetry ITC ITC itc experimental particp experimental participant identification experimental particp Wilson MD., Benlekbir S., Fradet-Turcotte A., Sherker A., Julien JP., McEwan A., Noordermeer SM., Sicheri F., Rubinstein JL., Durocher D. sicheri@lunenfeld.ca, john.rubinstein@ utoronto.ca, durocher@lunenfeld.ca, Nature 2016 Only protein-protein interactions imex curation imex curation ubb_human Polyubiquitin-B UBB protein protein human Homo sapiens Human MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC h4_xenla Histone H4 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG h2b1c_human Histone H2B type 1-C/E/F/G/I HIST1H2BG HIST1H2BI Histone H2B.1 A Histone H2B.a Histone H2B.g Histone H2B.h Histone H2B.k Histone H2B.l H2BC10 H2BC4 H2BC6 H2BC7 H2BC8 H2BFA H2BFG H2BFH H2BFK H2BFL HIST1H2BC HIST1H2BE HIST1H2BF protein protein human Homo sapiens Human MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK h32_xenla Histone H3.2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA h2a1_human Histone H2A type 1 H2AC11 H2AC13 H2AC15 H2AC16 H2AC17 H2AFC H2AFD H2AFI H2AFN H2AFP HIST1H2AG HIST1H2AI HIST1H2AK HIST1H2AL HIST1H2AM Histone H2A/ptl protein protein human Homo sapiens Human MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK tp53b_human TP53-binding protein 1 TP53BP1 protein protein human Homo sapiens Human MDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLDVVSNPEQTAGEERGDGNSGFNEHLKENKVADPVDSSNLDTCGSISQVIEQLPQPNRTSSVLGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLELSQSQDVEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTAQPSKDVHVVKEQNPPPARSEDMPFSPKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVLSTQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSLSTNSSDLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPPGSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDMHSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDEDGENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISILATGCKGREETVAEDVCIDLTCDSGSQAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGSSGSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVETSVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEKCSDSQSWEDIAPEIEPCAENRLDTKEEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRADDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSFCESSSETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESMVETHDPILGSGKGDSGAAPDVDDKLCLRMKLVSPETEASEESLQFNLEKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGDHTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRVPETVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTERGSGEKPVSAPGDDTESLHSQGEEEFDMPQPPHGHVLHRHMRTIREVRTLVTRVITDVYYVDGTEVERKVTEETEEPIVECQECETEVSPSQTGGSSGDLGDISSFSSKASSLHRTSSGTSLSAMHSSGSSGKGAGPLRGKTSGTEPADFALPSSRGGPGKLSPRKGVSQTGTPVCEEDGDAGLGIRQGGKAPVTPRGRGRRGRPPSRTTGTRETAVPGPLGIEDISPNLSPDDKSFSRVVPRVPDSTRRTDVGAGALRRSDSPEIPFQAAAGPSDGLDASSPGNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSNVSSPATPTASSSSSTTPTRKITESPRASMGVLSGKRKLITSEEERSPAKRGRKSATVKPGAVGAGEFVSPCESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLTMATTSDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH h2ac11-h2bc10-11 3471417 N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471425 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K21C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471426 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471427 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q12888:p.[Asp1616Ala;Asp1620Ala] D1616A,D1620A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q12888:p.[Asp1616Lys;Asp1620Lys] D1616K,D1620K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q12888:p.Ile1617Ala I1617A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q12888:p.Leu1619Ala L1619A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3b h2ac11-h2bc10-4 3471417 N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false UDR region UDR region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false native 53BP1 native 53BP1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471426 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K14R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K37R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471425 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K20C mutation mutation certain certain sequence position certain certain certain sequence position certain false Cysteine was further modified with 2-chloroethyl dimethylammonium chloride ecoli Escherichia coli (strain K12) N/A 3471427 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 2c h2ac11-h2bc10-5 3471417 N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471425 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K21C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471426 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62807:p.Lys109Glu K108E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P62807:p.His110Ala H109A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P62807:p.Glu106Ala E105A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471427 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Glu62Ala E61A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Glu92Ala E91A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Glu93Ala E92A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q12888:p.[Asp1616Ala;Asp1620Ala] D1616A,D1620A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q12888:p.[Asp1616Lys;Asp1620Lys] D1616K,D1620K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q12888:p.Ile1617Ala I1617A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q12888:p.Leu1619Ala L1619A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3d, Figure 4c h2ac11-h2bc10-6 3471417 N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471425 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K21C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471426 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471427 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q12888:p.Lys1626Ala K1626A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q12888:p.Arg1629Ala R1629A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q12888:p.Arg1627Ala R1627A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q12888:p.Lys1628Cys K1628C mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 3e h2ac11-h2bc10-7 3471417 N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471426 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62807:p.Thr120Glu T119E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P62807:p.Thr120Ala T119A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K13R mutation mutation certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471425 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K20C mutation mutation certain certain sequence position certain certain certain sequence position certain false Cysteine was further modified with 2-chloroethyl dimethylammonium chloride ecoli Escherichia coli (strain K12) N/A 3471427 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 5e h2ac11-h2bc10-8 3471417 N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0CG47:p.Ile44Ala I44A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P0CG47:p.[Lys6Glu;His68Glu] H68E, K6E mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471426 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K13R mutation mutation certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471425 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K20C mutation mutation certain certain sequence position certain certain certain sequence position certain false Cysteine was further modified with 2-chloroethyl dimethylammonium chloride ecoli Escherichia coli (strain K12) N/A 3471427 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 8d h2ac11-h2bc10-9 3471417 N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0CG47:p.Ile44Ala I44A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471425 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K21C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471426 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62807:p.Glu106Ala E105A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471427 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Glu62Ala E61A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Glu92Ala E91A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Glu93Ala E92A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 10d (Upper Right Picture) h2ac11-h2bc10-3 3471417 N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0CG47:p.Ile44Ala I44A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471425 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K21C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471426 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62807:p.Glu106Ala E105A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471427 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Glu62Ala E61A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Glu92Ala E91A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Glu93Ala E92A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Binding region Native region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 10d (Upper Left Picture) h2ac11-h2bc10-10 3471417 N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471425 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K21C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471426 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62807:p.Thr120Ala T119A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471427 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Binding region Native region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 10d (Lower Left Picture) h2ac11-h2bc10-12 3471417 N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471425 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K21C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471426 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62807:p.Thr120Ala T119A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471427 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false binding region binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 10d (Lower Right Picture) tp53bp1-hist1h2ag-1 3471418 N/A 3471427 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q12888:p.Leu1619Ala L1619A mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 2b tp53bp1-h32_xenla-3 3471418 N/A 3471427 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P0C0S8:p.Lys14Arg K14R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K37R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471426 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 5h tp53bp1-h32_xenla-2 3471418 N/A 3471426 predetermined predetermined participant predetermined unspecified role unspecified role ancillary ancillary purified purified P62807:p.Thr120Ala T120A mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P62807:p.Thr120Glu T120E mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471427 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 5c and 5f tp53bp1-h32_xenla-1 3471418 N/A 3471427 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q12888:p.[Asp1616Ala;Asp1620Ala] D1616A,D1620A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q12888:p.Asp1616Lys D1616K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q12888:p.Asp1620Lys D1620K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q12888:p.[Asp1616Lys;Asp1620Lys] D1616K,D1620K mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false Q12888:p.Ile1617Ala I1617A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false Q12888:p.Leu1619Ala L1619A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 8a tp53bp1-h32_xenla-6 3471418 N/A 3471424 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role ancillary ancillary purified purified P0CG47:p.[Lys6Glu;His68Glu] K6E,H68E mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P0CG47:p.Ile44Ala I44A mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false N/A 3471427 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 8c tp53bp1-h32_xenla-8 3471418 N/A 3471427 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false p.[Glu62Ala;Glu92_Glu93delinsAlaAla] E61A,E91A,E92A mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 9c tp53bp1-h32_xenla-10 3471418 N/A 3471427 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) N/A 3471428 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P0C0S8:p.Lys14Arg K13R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q12888:p.Arg1627Ala R1627A mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 5c and 5f, Extended Data Figure 9e tp53bp1-hist1h2bc-3 3471419 N/A 3471426 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P62807:p.Glu106Cys E105C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q12888:p.Lys1628Cys K1628C mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 3471679 3471674 direct interaction direct interaction false false false Extended Data Figure 7b tp53bp1-hist1h2bc-2 3471419 N/A 3471426 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P62807:p.Asn85Cys N84C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q12888:p.Thr1609Cys T1609C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 3471687 3471682 direct interaction direct interaction false false false Extended Data Figure 7b tp53bp1-hist1h2bc-4 3471419 N/A 3471426 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P62807:p.Asn85Cys N84C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q12888:p.Lys1628Cys K1628C mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) 3471695 3471690 direct interaction direct interaction false false false Extended Data Figure 7b tp53bp1-hist1h2bc-1 3471419 N/A 3471429 predetermined predetermined participant predetermined anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 3471426 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified P62807:p.Asn85Cys N84C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Extended Data Figure 7b h2ac11-h2bc10-1 3471420 N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3471429 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3471426 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3471428 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3471425 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K20C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Cysteine was further modified with 2-chloroethyl dimethylammonium chloride ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3471427 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false Figure 1b h2ac11-h2bc10-13 3471421 N/A 3471428 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified N/A 3471426 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471425 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K20C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) further modified as in Cryo-Em structure N/A 3471427 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 1a, Extended Data Figure 2g h32_xenla-h4_xenla-4 3471422 N/A 3471428 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K13R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K36R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) N/A 3471429 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false GST tag GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false his tag his tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecoli Escherichia coli (strain K12) N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified N/A 3471426 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) N/A 3471425 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K20C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) further modified as in Cryo-Em structure N/A 3471427 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association false false false Extended Data Figure 2g, Figure 1a h2ac11-h2bc10-2 3471423 N/A 3471424 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3471429 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false gst tag gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false Binding region Binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3471426 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3471428 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P0C0S8:p.Lys14Arg K14R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P0C0S8:p.Lys37Arg K37R mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3471425 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P62799:p.Lys21Cys K20C mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Cysteine was further modified with 2-chloroethyl dimethylammonium chloride ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 N/A 3471427 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false Extended Data Figure 2e