UniProt UniProt http://www.uniprot.org genin-2016-5 human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast Resident cell of connective tissue, mesodermally derived pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. paquis@hermes.unice.fr EMBO molecular medicine 2016 imex curation Only protein-protein interactions imex curation genin-2016-1 mouse-brain Mus musculus brain brain Brain [cerebrum] bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. Samples from isolated mitochondrion were electrophoresed on a 5–13% gradient polyacrylamide gel, then in the second dimension on a tricine–SDS–polyacrylamide gel. paquis@hermes.unice.fr EMBO molecular medicine 2016 imex curation Only protein-protein interactions imex curation genin-2016-2 human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast Resident cell of connective tissue, mesodermally derived bn-page blue native page bn-page western blot western blot Immuno blot Immuno blot Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. Samples from isolated mitochondrion were electrophoresed on a 5–13% gradient polyacrylamide gel, then in the second dimension on a tricine–SDS–polyacrylamide gel. paquis@hermes.unice.fr EMBO molecular medicine 2016 imex curation Only protein-protein interactions imex curation genin-2016-3 human-fibroblast Homo sapiens normal diploid fibroblasts (HDF0 fibroblast Fibroblast Resident cell of connective tissue, mesodermally derived anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. Samples from isolated mitochondrion were electrophoresed on a 5–13% gradient polyacrylamide gel, then in the second dimension on a tricine–SDS–polyacrylamide gel. paquis@hermes.unice.fr EMBO molecular medicine 2016 imex curation Only protein-protein interactions imex curation genin-2016-4 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V., Genin EC., Plutino M., Bannwarth S., Villa E., Cisneros-Barroso E., Roy M., Ortega-Vila B., Fragaki K., Lespinasse F., Pinero-Martos E., Augé G., Moore D., Burté F., Lacas-Gervais S., Kageyama Y., Itoh K., Yu-Wai-Man P., Sesaki H., Ricci JE., Vives-Bauza C., Paquis-Flucklinger V. Samples from isolated mitochondrion were electrophoresed on a 5–13% gradient polyacrylamide gel, then in the second dimension on a tricine–SDS–polyacrylamide gel. paquis@hermes.unice.fr EMBO molecular medicine 2016 imex curation Only protein-protein interactions imex curation chc10_human Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial Protein N27C7-4 CHCHD10 C22orf16 protein protein human Homo sapiens Human MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP mic60_human MICOS complex subunit MIC60 Mitofilin p87/89 Cell proliferation-inducing gene 4/52 protein MIC60 IMMT HMP MINOS2 Mitochondrial inner membrane protein PIG4 PIG52 protein protein human Homo sapiens Human MLRACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLKAKEELEKMKSVIENAKKKEVAGAKPHITAAEGKLHNMIVDLDNVVKKVQAAQSEAKVVSQYHELVVQARDDFKRELDSITPEVLPGWKGMSVSDLADKLSTDDLNSLIAHAHRRIDQLNRELAEQKATEKQHITLALEKQKLEEKRAFDSAVAKALEHHRSEIQAEQDRKIEEVRDAMENEMRTQLRRQAAAHTDHLRDVLRVQEQELKSEFEQNLSEKLSEQELQFRRLSQEQVDNFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSMKTSSAETPTIPLGSAVEAIKANCSDNEFTQALTAAIPPESLTRGVYSEETLRARFYAVQKLARRVAMIDETRNSLYQYFLSYLQSLLLFPPQQLKPPPELCPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARMTLETKQIVEILTAYASAVGIGTTQVQPE mic25_human MICOS complex subunit MIC25 CHCHD6 CHCM1 Coiled-coil-helix cristae morphology protein 1 Coiled-coil-helix-coiled-coil-helix domain-containing protein 6 MIC25 protein protein human Homo sapiens Human MGSTESSEGRRVSFGVDEEERVRVLQGVRLSENVVNRMKEPSSPPPAPTSSTFGLQDGNLRAPHKESTLPRSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKASLPTGEGSISHEEQKSVRLARELESREAELRRRDTFYKEQLERIERKNAEMYKLSSEQFHEAASKMESTIKPRRVEPVCSGLQAQILHCYRDRPHEVLLCSDLVKAYQRCVSAAHKG mic19_mouse MICOS complex subunit Mic19 Chchd3 Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 Mic19 protein protein mouse Mus musculus Mouse MGGTASTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSSVYGASVSDEDLKRRVAEELALEQAKKESEHQRRLKQARDLERERAAANEQLTRAVLRERISSEEERMKAKHLARQLEEKDRVMRKQDAFYKEQLARLEERSSEFYKVTTEEYQKAAEEVEAKFKRYEYHPVCADLQTKILQCYRQNTQQTLSCSALASQYMHCVNHAKQSMLEKGG mic25_mouse MICOS complex subunit Mic25 Coiled-coil-helix-coiled-coil-helix domain-containing protein 6 Mic25 Chchd6 protein protein mouse Mus musculus Mouse MGSAESAEARRVSFEMDEEERVRVLQGIRLSESVVNRMKDCSQPSAGEQLVPGFGPSSSAPVPTVPLPAISVPTVPAPTTPVPTAPSSSVRGLPGGTCKGPLTDVKVPSAESGGGLQSSAVKEDLKKFQQEQLAVQDEMVRVAKKEKEAAEKHLKASLPKKKASLTHEQQQSARLARELEDREAELSRRDTFYKEQQGRIQEKNAELYKLSSQQFHEAASKAESTIKPRRVEPVCSGLQAQILRCYRDHLHEVLLCSDLVKAYQHCVSTARKG q7tnl9_mouse Chchd10 Ndg2 protein protein mouse Mus musculus Mouse MPRGSRSAAARPVSRPAPPPAHPPPSAAAPAPAAPGQPGLMAQMASTAAGVAVGSAVGHVMGSALTSAFSGGNSEPAQPAVQQAPARPASHPLQMGPCSYEIKQFLDCSTTQSDLTLCEGFSEALKQCKYNHGLSSLP mic60_mouse MICOS complex subunit Mic60 Mitofilin Immt Mic60 Mitochondrial inner membrane protein protein protein mouse Mus musculus Mouse MLRACQLSGVTVAAQSCLCGKFVLRPLRPCRRYSTSSSSGLTAGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFGMVLGSAPYTVPLPKKPVQSGPLKISSVSEVMKDSKLPVAQSQKTKGDTPASAASTGAAQIISAAGDTLSVPAPAVQHEDTIKTECPNTNEGKSTSETTEEAFSSSVRERPPEEVAARLAQQEKQEQVEMESLAKSLEDALNRTSSVTLQTITAQNAAVQAVKAHSNILKTAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLKAKEELEKMKTIIEDAKKREIAGATPHITAAEGRLHNMIVDLDNVVKKVQAAQSEAKVVSQYHELVVQARDDFRKELDSITPDITPGWKGMSISDLAGKLSTDDLNSLIAHAHRRIDQLNRELAQQKATEKQHIELALEKHKLEEKRTFDSAVAKALEHHRSEIQAEQDRKVEEVRDAMENEMRTQLRRQAAAHTDHLRDVLKVQEQELKYEFEQGLSEKLSEQELEFRRRSQEQMDSFTLDINTAYARLRGIEQAVQSHAVAEEEARKAHQLWLSVEALKYSMKTSSAEMPTIPLGSAVEAIRVNCSDNEFTQALTAAIPPESLTRGVYSEETLRARFYAVQKLARRVAMIDETRNSLYQYFLSYLQSLLLFPPKQLKPPAELYPEDINTFKLLSYASYCIEHGDLELAAKFVNQLKGESRRVAQDWLKEARMTLETKQIVEILTAYASAVGIGTTQVQQE mic19_human MICOS complex subunit MIC19 CHCHD3 MINOS3 Coiled-coil-helix-coiled-coil-helix domain-containing protein 3 MIC19 protein protein human Homo sapiens Human MGGTTSTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKRLKQAKELDRERAAANEQLTRAILRERICSEEERAKAKHLARQLEEKDRVLKKQDAFYKEQLARLEERSSEFYRVTTEQYQKAAEEVEAKFKRYESHPVCADLQAKILQCYRENTHQTLKCSALATQYMHCVNHAKQSMLEKGG chchd10-immt-1 3326326 N/A 3326331 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3326332 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 2B chchd10-chchd6-2 3326326 N/A 3326331 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3326333 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous proximity proximity close-contact colocalization neighbourhood interaction false false false Fig. 2B chchd10-chchd6-1 3326327 N/A 3326334 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3326335 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3326336 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3326337 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous physical association physical association false false false Fig. 1A chchd10-chchd3-1 3326328 N/A 3326338 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3326333 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3326331 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3326332 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous physical association physical association false false false Fig. 1C chchd10-chchd3-2 3326329 N/A 3326338 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3326331 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3326332 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous association association false false false Fig. 2A immt-chchd10-1 3326330 N/A 3326331 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous N/A 3326332 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level naturally occurring naturally occurring endogenous endogenous physical association physical association false false false Fig. 2A