UniProt UniProt http://www.uniprot.org tsachaki-2013-1 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tsachaki M., Fotinopoulou A., Slavi N., Zarkou V., Ghiso J., Efthimiopoulos S. efthis@biol.uoa.gr Current Alzheimer research 2013 imex curation Only protein-protein interactions imex curation tsachaki-2013-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Tsachaki M., Fotinopoulou A., Slavi N., Zarkou V., Ghiso J., Efthimiopoulos S. efthis@biol.uoa.gr Current Alzheimer research 2013 imex curation Only protein-protein interactions imex curation tsachaki-2013-3 human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Tsachaki M., Fotinopoulou A., Slavi N., Zarkou V., Ghiso J., Efthimiopoulos S. efthis@biol.uoa.gr Current Alzheimer research 2013 imex curation Only protein-protein interactions imex curation tsachaki-2013-4 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Tsachaki M., Fotinopoulou A., Slavi N., Zarkou V., Ghiso J., Efthimiopoulos S. efthis@biol.uoa.gr Current Alzheimer research 2013 imex curation Only protein-protein interactions imex curation bace1_human Beta-secretase 1 BACE KIAA1149 Beta-site amyloid precursor protein cleaving enzyme 1 Membrane-associated aspartic protease 2 Memapsin-2 Aspartyl protease 2 BACE1 protein protein human Homo sapiens Human MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQHDDFADDISLLK 377CE4C824ACEF05 itm2b_human Integral membrane protein 2B ITM2B BRI BRI2 Protein E25B Transmembrane protein BRI Immature BRI2 protein protein human Homo sapiens Human MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS bace1-itm2b-1 3531376 N/A 3531380 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3531381 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2A bace1-itm2b-2 3531377 N/A 3531380 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed N/A 3531381 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2B bace1-itm2b-3 3531378 N/A 3531380 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3531381 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 2C itm2b-bace1-1 3531379 N/A 3531380 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed N/A 3531381 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Fig. 3