UniProt UniProt http://www.uniprot.org yamaguchi-2011-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Yamaguchi A., Kitajo K., Yamaguchi A., Kitajo K. atsyama@restaff.chiba-u.jp Human fetal brain cDNA PloS one 2011 Only protein-protein interactions imex curation imex curation yamaguchi-2011-2 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Yamaguchi A., Kitajo K., Yamaguchi A., Kitajo K. atsyama@restaff.chiba-u.jp Human fetal brain cDNA PloS one 2011 Only protein-protein interactions imex curation imex curation yamaguchi-2011-3 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yamaguchi A., Kitajo K., Yamaguchi A., Kitajo K. atsyama@restaff.chiba-u.jp Human fetal brain cDNA PloS one 2011 Only protein-protein interactions imex curation imex curation yamaguchi-2011-4 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Yamaguchi A., Kitajo K., Yamaguchi A., Kitajo K. atsyama@restaff.chiba-u.jp Human fetal brain cDNA PloS one 2011 Only protein-protein interactions imex curation imex curation yamaguchi-2011-5 human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Yamaguchi A., Kitajo K., Yamaguchi A., Kitajo K. atsyama@restaff.chiba-u.jp Human fetal brain cDNA PloS one 2011 Only protein-protein interactions imex curation imex curation yamaguchi-2011-6 mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yamaguchi A., Kitajo K., Yamaguchi A., Kitajo K. atsyama@restaff.chiba-u.jp Human fetal brain cDNA PloS one 2011 Only protein-protein interactions imex curation imex curation yamaguchi-2011-7 mouse-brain Mus musculus brain brain Brain [cerebrum] fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Yamaguchi A., Kitajo K., Yamaguchi A., Kitajo K. atsyama@restaff.chiba-u.jp Human fetal brain cDNA PloS one 2011 Only protein-protein interactions imex curation imex curation yamaguchi-2011-8 mouse-spinal-cord Mouse spinal cord spinal-cord spinal cord fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Yamaguchi A., Kitajo K., Yamaguchi A., Kitajo K. atsyama@restaff.chiba-u.jp Human fetal brain cDNA PloS one 2011 Only protein-protein interactions imex curation imex curation yamaguchi-2011-9 in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as predetermined predetermined participant predetermined Yamaguchi A., Kitajo K., Yamaguchi A., Kitajo K. atsyama@restaff.chiba-u.jp Human fetal brain cDNA PloS one 2011 Only protein-protein interactions imex curation imex curation yamaguchi-2011-10 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging anti-tag immunocytochemistry anti-tag immunocytochemistry Yamaguchi A., Kitajo K., Yamaguchi A., Kitajo K. atsyama@restaff.chiba-u.jp Human fetal brain cDNA PloS one 2011 Only protein-protein interactions imex curation imex curation anm1_human Protein arginine N-methyltransferase 1 PRMT1 Interferon receptor 1-bound protein 4 Histone-arginine N-methyltransferase PRMT1 HMT2 HRMT1L2 IR1B4 protein protein human Homo sapiens Human MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR fus_human RNA-binding protein FUS FUS TLS Oncogene FUS Oncogene TLS Translocated in liposarcoma protein POMp75 75 kDa DNA-pairing protein protein protein human Homo sapiens Human MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY q99873-3 Protein arginine N-methyltransferase 1 PRMT1 HMT2 HRMT1L2 Histone-arginine N-methyltransferase PRMT1 IR1B4 Interferon receptor 1-bound protein 4 V1 protein protein human Homo sapiens Human MAAAEAANCIMEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR anm1_mouse Protein arginine N-methyltransferase 1 Prmt1 Mrmt1 Hrmt1l2 Histone-arginine N-methyltransferase PRMT1 protein protein mouse Mus musculus Mouse MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR fus_mouse RNA-binding protein FUS Fus Protein pigpen protein protein mouse Mus musculus Mouse MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYGQSADTSGYGQSSYGSSYGQTQNTGYGTQSAPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGGSSQSSSYGQPQSGGYGQQSGYGGQQQSYGQQQSSYNPPQGYGQQNQYNSSSGGGGGGGGGNYGQDQSSMSGGGGGGGYGNQDQSGGGGGGYGGGQQDRGGRGRGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY fus-prmt1-1 3531658 N/A 3531668 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed N/A 3531669 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed physical association physical association false false false na To search for novel binding partners of FUS/TLS in the central nervous system, we performed a yeast two-hybrid screening on human fetal brain cDNA library using full length human FUS/TLS (amino acid 1-526) as a bait and identified several positive clones. Among them, at least six clones (#2, #9,#15, #56, #59 and #60) were identical to human PRMT1 transcript variant 3 (accession number NM_198318). fus-prmt1-2 3531659 N/A 3531670 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3531669 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1A fus-prmt1-3 3531660 N/A 3531668 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3531669 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 1B, Supp. Fig. 1 Interaction occurs in the presence of RNase A and DNase I indicating that the interaction is not mediated by nucleic acids fus-prmt1-4 3531661 N/A 3531668 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3531669 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Fig. 1C fus-prmt1-5 3531662 N/A 3531668 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3531669 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Fig. 1C, 7A fus-prmt1-6 3531663 N/A 3531671 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3531672 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 2A fus-prmt1-7 3531664 N/A 3531671 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3531672 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Fig. 2B, 2C fus-prmt1-8 3531665 N/A 3531671 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3531672 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Fig. 3B fus-prmt1-9 3531666 N/A 3531670 enzyme enzyme unspecified role unspecified role purified purified region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3531669 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) methylation methylation reaction methylation false false false Fig. 4A fus-prmt1-10 3531667 N/A 3531670 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3531669 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 6C