UniProt UniProt http://www.uniprot.org dornier-2012-1 human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dornier E., Coumailleau F., Ottavi JF., Moretti J., Boucheix C., Mauduit P., Schweisguth F., Rubinstein E. eric.rubinstein@inserm.fr The Journal of cell biology 2012 Only protein-protein interactions imex curation imex curation dornier-2012-2 human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dornier E., Coumailleau F., Ottavi JF., Moretti J., Boucheix C., Mauduit P., Schweisguth F., Rubinstein E. eric.rubinstein@inserm.fr The Journal of cell biology 2012 Only protein-protein interactions imex curation imex curation dornier-2012-4 human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 crosslink cross-linking study crosslink anti tag western anti tag western blot anti tag western Dornier E., Coumailleau F., Ottavi JF., Moretti J., Boucheix C., Mauduit P., Schweisguth F., Rubinstein E. Crosslinker - DSP (dithiobis(succinimidyl propionate)) eric.rubinstein@inserm.fr The Journal of cell biology 2012 Only protein-protein interactions imex curation imex curation dornier-2012-8 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunohistochemistry immunohistochemistry Dornier E., Coumailleau F., Ottavi JF., Moretti J., Boucheix C., Mauduit P., Schweisguth F., Rubinstein E. eric.rubinstein@inserm.fr The Journal of cell biology 2012 Only protein-protein interactions imex curation imex curation dornier-2012-6 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Dornier E., Coumailleau F., Ottavi JF., Moretti J., Boucheix C., Mauduit P., Schweisguth F., Rubinstein E. eric.rubinstein@inserm.fr The Journal of cell biology 2012 Only protein-protein interactions imex curation imex curation dornier-2012-7 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Dornier E., Coumailleau F., Ottavi JF., Moretti J., Boucheix C., Mauduit P., Schweisguth F., Rubinstein E. eric.rubinstein@inserm.fr The Journal of cell biology 2012 Only protein-protein interactions imex curation imex curation dornier-2012-5 drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Dornier E., Coumailleau F., Ottavi JF., Moretti J., Boucheix C., Mauduit P., Schweisguth F., Rubinstein E. Crosslinker - DSP (dithiobis(succinimidyl propionate)) eric.rubinstein@inserm.fr The Journal of cell biology 2012 Only protein-protein interactions imex curation imex curation dornier-2012-3 human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Dornier E., Coumailleau F., Ottavi JF., Moretti J., Boucheix C., Mauduit P., Schweisguth F., Rubinstein E. eric.rubinstein@inserm.fr The Journal of cell biology 2012 Only protein-protein interactions imex curation imex curation ada10_human Disintegrin and metalloproteinase domain-containing protein 10 ADAM10 KUZ MADM Mammalian disintegrin-metalloprotease Kuzbanian protein homolog CDw156 protein protein human Homo sapiens Human MVLLRVLILLLSWAAGMGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFLRLDFHAHGRHFNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVIDGRFEGFIQTRGGTFYVEPAERYIKDRTLPFHSVIYHEDDINYPHKYGPQGGCADHSVFERMRKYQMTGVEEVTQIPQEEHAANGPELLRKKRTTSAEKNTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAREGICNGFTALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKYGLEECTCASSDGKDDKELCHVCCMKKMDPSTCASTGSVQWSRHFSGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKAIFSPELYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTLKRRRPPQPIQQPQRQRPRESYQMGHMRR fprp_human Prostaglandin F2 receptor negative regulator PTGFRN CD9P1 EWIF FPRP KIAA1436 CD9 partner 1 Glu-Trp-Ile EWI motif-containing protein F Prostaglandin F2-alpha receptor regulatory protein Prostaglandin F2-alpha receptor-associated protein protein protein human Homo sapiens Human MGRLASRPLLLALLSLALCRGRVVRVPTATLVRVVGTELVIPCNVSDYDGPSEQNFDWSFSSLGSSFVELASTWEVGFPAQLYQERLQRGEILLRRTANDAVELHIKNVQPSDQGHYKCSTPSTDATVQGNYEDTVQVKVLADSLHVGPSARPPPSLSLREGEPFELRCTAASASPLHTHLALLWEVHRGPARRSVLALTHEGRFHPGLGYEQRYHSGDVRLDTVGSDAYRLSVSRALSADQGSYRCIVSEWIAEQGNWQEIQEKAVEVATVVIQPSVLRAAVPKNVSVAEGKELDLTCNITTDRADDVRPEVTWSFSRMPDSTLPGSRVLARLDRDSLVHSSPHVALSHVDARSYHLLVRDVSKENSGYYYCHVSLWAPGHNRSWHKVAEAVSSPAGVGVTWLEPDYQVYLNASKVPGFADDPTELACRVVDTKSGEANVRFTVSWYYRMNRRSDNVVTSELLAVMDGDWTLKYGERSKQRAQDGDFIFSKEHTDTFNFRIQRTTEEDRGNYYCVVSAWTKQRNNSWVKSKDVFSKPVNIFWALEDSVLVVKARQPKPFFAAGNTFEMTCKVSSKNIKSPRYSVLIMAEKPVGDLSSPNETKYIISLDQDSVVKLENWTDASRVDGVVLEKVQEDEFRYRMYQTQVSDAGLYRCMVTAWSPVRGSLWREAATSLSNPIEIDFQTSGPIFNASVHSDTPSVIRGDLIKLFCIITVEGAALDPDDMAFDVSWFAVHSFGLDKAPVLLSSLDRKGIVTTSRRDWKSDLSLERVSVLEFLLQVHGSEDQDFGNYYCSVTPWVKSPTGSWQKEAEIHSKPVFITVKMDVLNAFKYPLLIGVGLSTVIGLLSCLIGYCSSHWCCKKEVQETRRERRRLMSMEMD cd9_human CD9 antigen CD9 MIC3 TSPAN29 5H9 antigen Cell growth-inhibiting gene 2 protein Leukocyte antigen MIC3 Motility-related protein Tetraspanin-29 p24 GIG2 protein protein human Homo sapiens Human MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV cd81_human CD81 antigen 26 kDa cell surface protein TAPA-1 Target of the antiproliferative antibody 1 Tetraspanin-28 CD81 TAPA1 TSPAN28 protein protein human Homo sapiens Human MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY cd151_human CD151 antigen CD151 GP27 Membrane glycoprotein SFA-1 Platelet-endothelial tetraspan antigen 3 TSPAN24 Tetraspanin-24 protein protein human Homo sapiens Human MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY tsn5_human Tetraspanin-5 TSPAN5 TM4SF9 Tetraspan NET-4 Transmembrane 4 superfamily member 9 protein protein human Homo sapiens Human MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGITFLGIGLWAWNEKGVLSNISSITDLGGFDPVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIKDQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIFIGIALLQIFGICLAQNLVSDIEAVRASW tsn14_human Tetraspanin-14 TSPAN14 TM4SF14 DC-TM4F2 Transmembrane 4 superfamily member 14 protein protein human Homo sapiens Human MHYYRYSNAKVSCWYKYLLFSYNIIFWLAGVVFLGVGLWAWSEKGVLSDLTKVTRMHGIDPVVLVLMVGVVMFTLGFAGCVGALRENICLLNFFCGTIVLIFFLELAVAVLAFLFQDWVRDRFREFFESNIKSYRDDIDLQNLIDSLQKANQCCGAYGPEDWDLNVYFNCSGASYSREKCGVPFSCCVPDPAQKVVNTQCGYDVRIQLKSKWDESIFTKGCIQALESWLPRNIYIVAGVFIAISLLQIFGIFLARTLISDIEAVKAGHHF tsn15_human Tetraspanin-15 TSPAN15 NET7 TM4SF15 Tetraspan NET-7 UNQ677/PRO1311 Transmembrane 4 superfamily member 15 protein protein human Homo sapiens Human MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGALVLSVGIYAEVERQKYKTLESAFLAPAIILILLGVVMFMVSFIGVLASLRDNLYLLQAFMYILGICLIMELIGGVVALTFRNQTIDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDWSKNQYHDCSAPGPLACGVPYTCCIRNTTEVVNTMCGYKTIDKERFSVQDVIYVRGCTNAVIIWFMDNYTIMAGILLGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGCCLCYPN mint homomint tsn17_human Tetraspanin-17 Transmembrane 4 superfamily member 17 Tetraspan protein SB134 F-box only protein 23 TSPAN17 FBXO23 TM4SF17 protein protein human Homo sapiens Human MPGKHQHFQEPEVGCCGKYFLFGFNIVFWVLGALFLAIGLWAWGEKGVLSNISALTDLGGLDPVWLFVVVGGVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWIRDQLNLFINNNVKAYRDDIDLQNLIDFAQEYWSCCGARGPNDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAEDVLNTQCGYDVRLKLELEQQGFIHTKGCVGQFEKWLQDNLIVVAGVFMGIALLQIFGICLAQNLVSDIKAVKANW tsn33_human Tetraspanin-33 TSPAN33 PEN Penumbra Proerythroblast new membrane protein protein human Homo sapiens Human MARRPRAPAASGEEFSFVSPLVKYLLFFFNMLFWVISMVMVAVGVYARLMKHAEAALACLAVDPAILLIVVGVLMFLLTFCGCIGSLRENICLLQTFSLCLTAVFLLQLAAGILGFVFSDKARGKVSEIINNAIVHYRDDLDLQNLIDFGQKKFSCCGGISYKDWSQNMYFNCSEDNPSRERCSVPYSCCLPTPDQAVINTMCGQGMQAFDYLEASKVIYTNGCIDKLVNWIHSNLFLLGGVALGLAIPQLVGILLSQILVNQIKDQIKLQLYNQQHRADPWY tsn10_human Tetraspanin-10 TSPAN10 OCSP Oculospanin protein protein human Homo sapiens Human MEEGERSPLLSQETAGQKPLSVHRPPTSGCLGPVPREDQAEAWGCSCCPPETKHQALSGTPKKGPAPSLSPGSSCVKYLIFLSNFPFSLLGLLALAIGLWGLAVKGSLGSDLGGPLPTDPMLGLALGGLVVSAASLAGCLGALCENTCLLRGFSGGILAFLVLEAVAGALVVALWGPLQDSLEHTLRVAIAHYQDDPDLRFLLDQVQLGLRCCGAASYQDWQQNLYFNCSSPGVQACSLPASCCIDPREDGASVNDQCGFGVLRLDADAAQRVVYLEGCGPPLRRWLRANLAASGGYAIAVVLLQGAELLLAARLLGALAARSGAAYGPGAHGEDRAGPQSPSPGAPPAAKPARG mint homomint ada10_bovin Disintegrin and metalloproteinase domain-containing protein 10 ADAM10 MADM Kuzbanian protein homolog Mammalian disintegrin-metalloprotease Myelin-associated metalloproteinase protein protein bovin Bos taurus (Bovine) Bovine MVLLRVLILLLSWVAGLGGQYGNPLNKYIRHYEGLSYDVDSLHQKHQRAKRAVSHEDQFLRLDFHAHGRHFNLRMKRDTSLFSEEFRVETSNAVLDYDTSHIYTGHIYGEEGSFSHGSVIDGRFEGFIQTHGGTFYVEPAERYIKDRTLPFHSVIYHEDDIKYPHKYGPQGGCADHSVFERMRKYQMTGVEEVTQTPQEKHAINGPELLRKKRTTVAEKNTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTADEKDPTNPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCYDANQPEGKKCKLKPGKQCSPSQGPCCTAHCAFKSKTEKCRDDSDCAKEGICNGITALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKHGLEECTCASSDGKDDKELCHVCCMKKMEPSTCASTGSVQWNKYFLGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKAIFSPELYENIAEWIVAYWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTLKRRRPPQPIQQPQRQRPRESYQMGHMRR q9w4x6_drome Tetraspanin Tsp3A BACR7C10.6 Dm.Tsp3A Dmel\CG10742 EG:BACR7C10.6 tsp3A Tsp3A-RA CG10742 Dmel_CG10742 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSNYRYQGAGLGGVGMAGGRGYSGIEVHEVMHPHHFTYVSQCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLENFYDVFLNISLVMILAGTVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKIIHSYRDDPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATDISSGLVNIMCGYGVQNAPVPEATKLIWTSGCIEIVRVWAEHNLYVIAGNALGIALIQLLVIYLAKTLEGQIELQKSRWLA q9vjw9_drome 11410 34Da ADAM10 BG:DS07660.3 CT22079 Dmel\CG7147 GS11410 Kuz br38 l(2)03782 l(2)34Da l(2)br38 l(2)c00136 l(2)k01403 l34Da soy nut Dmel_CG7147 kuz CG7147 KUZ protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSSKCAFNIVFVSIIFIIIVNGYAKDISGVKRGHERLNEYISHYETLNYDHEHIRASHNRARRSVTKDQYVHLKFASHGRDFHLRLKRDLNTFSNKLDFYDSKGPIDVSTDHIYEGEVIGDRNSYVFGSIHNGVFEGKIITERDAYYVEHAKHYFPTNRTATTTPPSTSTTSSATTATKSTQPTRPLAKSNTSTTAVNSKTENFIKKIAESTTTSQQLPEYTESSSSSTTTFPPTTEYFEDEKERNAEDELDFHSIIYKESHVEDAYENVREGHVAGCGITDEVSQWMENIQNSAVEELPEPMSKDYQKLHRKQLHKKSAPQQQQQPHPPKKYISGDEDFKYPHQKYTKEANFAEGAFYDPSTGRRLGSSANVADWHQLVHERVRRATDNGAGDRGSSGGSGRGREDNKNTCSLYIQTDPLIWRHIREGIADHDRGRKYEVDEKTREEITSLIAHHVTAVNYIYRNTKFDGRTEHRNIRFEVQRIKIDDDSACRNSYNGPHNAFCNEHMDVSNFLNLHSLEDHSDFCLAYVFTYRDFTGGTLGLAWVASASGASGGICEKYKTYTETVGGQYQSTKRSLNTGIITFVNYNSRVPPKVSQLTLAHEIGHNFGSPHDYPQECRPGGLNGNYIMFASATSGDRPNNSKFSPCSIRNISNVLDVLVGNTKRDCFKASEGAFCGNKIVESGEECDCGFNEEECKDKCCYPRLISEYDQSLNSSAKGCTRRAKTQCSPSQGPCCLSNSCTFVPTSYHQKCKEETECSWSSTCNGTTAECPEPRHRDDKTMCNNGTALCIRGECSGSPCLLWNMTKCFLTSTTLPHVSKRKLCDLACQDGNDTSTCRSTSEFADKYNIQKGGISLQPGSPCDNFQGYCDVFLKCRAVDADGPLLRLKNLLLNRKTLQTVAEWIVDNWYLVVLMGVAFIVVMGSFIKCCAVHTPSSNPKKRRARRISETLRAPMNTLRRMQRHPNQRGAGPRSIPPPAHEAQHYSRGGDGRGGGGGGGGRHGGSRSHHQQHPHDWDRHQGGHSIVPLPTGGSHSSRNSAANQARRSDGRGPRSTSSGRPQAIASGSGAASGAARSHGGYGAEQAIPGSIGGGVQAAISSGGVVARAQLPLPLPPPNGQQQMQQQQQLQLQQPAISPQQQPQQAFYTPKELPPRNKSRSSRTNNTSNTTTTTNSSTAAAGSGSVSGPGSGAGSSSKSKSGKSAKAKDSKSQKSQQANNSRSSSKEKGVKPVRRNIVY cd9-adam10-5 3524448 N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524457 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524458 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524459 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. 1A Cells pre-treated with Brij97 detergent cd9-ptgfrn-1 3524448 N/A 3524457 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524458 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 1A Cells pre-treated with digitonin detergent cd81-adam10-1 3524448 N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524457 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524459 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524458 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. 1A Cells pre-treated with Brij97 detergent cd151-adam10-2 3524448 N/A 3524460 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524457 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524459 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524458 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. 1A Cells pre-treated with Brij97 detergent ptgfrn-cd9-2 3524448 N/A 3524457 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524458 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 1A Cells pre-treated with digitonin detergent ptgfrn-adam10-1 3524448 N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524457 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524459 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524458 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. 1A Cells pre-treated with Brij97 detergent adam10-cd81-1 3524448 N/A 3524456 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524457 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524459 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3524458 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Fig. 1A Cells pre-treated with Brij97 detergent tspan5-adam10-5 3524449 N/A 3524461 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 1C, 1D A Tspan5 molecule mutated at all four putative palmitoylation sites still interacted with ADAM10. tspan14-adam10-3 3524449 N/A 3524462 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 1C tspan15-adam10-5 3524449 N/A 3524463 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 1C tspan17-adam10-1 3524449 N/A 3524464 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 1C tspan33-adam10-1 3524449 N/A 3524465 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 1C tspan10-adam10-1 3524449 N/A 3524466 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 1C tspan5-adam10-4 3524449 N/A 3524461 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 1B A Tspan5 molecule mutated at all four putative palmitoylation sites still interacted with ADAM10. adam10-tspan15-1 3524450 N/A 3524464 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524467 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1E tspan33-adam10-2 3524450 N/A 3524465 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524467 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1E tspan17-adam10-2 3524450 N/A 3524462 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524467 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1E tspan5-adam10-7 3524450 N/A 3524461 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524467 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 1E adam10-tspan14-4 3524451 N/A 3524462 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Fig. 5A adam10-tspan5-2 3524451 N/A 3524461 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Fig. 5A adam10-tspan15-4 3524451 N/A 3524463 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Fig. 5A adam10-tspan33-1 3524451 N/A 3524465 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false Fig. 5A tspan14-adam10-4 3524452 N/A 3524462 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 4C tspan15-adam10-6 3524452 N/A 3524463 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 4C tspan5-adam10-8 3524452 N/A 3524461 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 4C A Tspan5 molecule mutated at all four putative palmitoylation sites still interacted with ADAM10. adam10-tspan14-1 3524453 N/A 3524462 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 4C adam10-tspan15-2 3524453 N/A 3524463 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 4C adam10-tspan5-1 3524453 N/A 3524461 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 4C A Tspan5 molecule mutated at all four putative palmitoylation sites still interacted with ADAM10. kuz-tsp3a-1 3524454 N/A 3524468 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524469 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 1F tsp3a-kuz-1 3524454 N/A 3524468 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524469 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig. 1F tspan5-adam10-6 3524455 N/A 3524461 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3524456 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Fig. 1C