IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ henderson-2007-2 in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Henderson KN., Tye-Din JA., Reid HH., Chen Z., Borg NA., Beissbarth T., Tatham A., Mannering SI., Purcell AW., Dudek NL., van Heel DA., McCluskey J., Rossjohn J., Anderson RP. The HLA-DQA1 and DQB1 sequences added here have been taken from those given in PDBe database;the DQA1 sequence corresponds to HLA-DQA1 allele DQA1*03:01:01. The DQB1 sequence corresponds to allele DQB1*03:02. (both alleles found in the 9031 lymphblastoid cell line.) banderson@wehi.edu.au,jamie.rossjohn@med.monash.edu.au Immunity 2007 Only protein-protein interactions imex curation imex curation henderson-2007-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Henderson KN., Tye-Din JA., Reid HH., Chen Z., Borg NA., Beissbarth T., Tatham A., Mannering SI., Purcell AW., Dudek NL., van Heel DA., McCluskey J., Rossjohn J., Anderson RP. The HLA-DQA1 and DQB1 sequences added here have been taken from those given in PDBe database;the DQA1 sequence corresponds to HLA-DQA1 allele DQA1*03:01:01. The DQB1 sequence corresponds to allele DQB1*03:02. (both alleles found in the 9031 lymphblastoid cell line.) banderson@wehi.edu.au,jamie.rossjohn@med.monash.edu.au Immunity 2007 Only protein-protein interactions imex curation imex curation dqb1_human HLA class II histocompatibility antigen, DQ beta 1 chain HLA-DQB1 HLA-DQB MHC class II antigen DQB1 protein protein human Homo sapiens Human MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH dqa1_human HLA class II histocompatibility antigen, DQ alpha 1 chain DC-alpha HLA-DCA DC-1 alpha chain MHC class II DQA1 HLA-DQA1 protein protein human Homo sapiens Human MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL hg2a_human HLA class II histocompatibility antigen gamma chain DHLAG HLA-DR antigens-associated invariant chain Ia antigen-associated invariant chain CD74 protein protein human Homo sapiens Human MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM gda9_wheat Alpha/beta-gliadin MM1 Prolamin protein protein wheat Triticum aestivum (Wheat) MKTFLILALLAIVATTARIAVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFPGQQQPFPPQQPYPQPQPFPSQQPYLQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPFRPQQPYPQSQPQYSQPQQPISQQQQQQQQQQQQKQQQQQQQQILQQILQQQLIPCRDVVLQQHSIAYGSSQVLQQSTYQLVQQLCCQQLWQIPEQSRCQAIHNVVHAIILHQQQQQQQQQQQQPLSQVSFQQPQQQYPSGQGSFQPSQQNPQAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYCTIAPVGIFGTN cd74-hla_dqa1-1 3432861 N/A 3432863 unspecified role unspecified role bait bait cell lysate cell lysate p.[Ala45Gly;Tyr58Leu;Glu77Gly;Asp89Ala;His199Arg;Thr217Ile] variant variant certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-9031 human Boleth_9031, EBV transformed lymphoblastoid cell line Human 9031 Boleth_9031, EBV transformed lymphoblastoid cell line ECACC:88052031 HLA typed. N/A 3432864 unspecified role unspecified role bait bait cell lysate cell lysate p.val73_Asp80delinsLeuPheArgArgPheArgArgPhe variant variant certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false p.[Thr49Ser;Gln57Glu;Gly63Glu;Cys70Gln;Ile129Thr;Leu178Phe;Glu183Asp;Ser185Ile;Lys197Glu] variant variant certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false p.Ser97_Leu98delinsIleVal variant variant certain certain sequence position certain certain certain sequence position certain false human-9031 human Boleth_9031, EBV transformed lymphoblastoid cell line Human 9031 Boleth_9031, EBV transformed lymphoblastoid cell line ECACC:88052031 HLA typed. N/A 3432865 unspecified role unspecified role prey prey purified purified clip_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) 3432873 3432870 physical association physical association false false false Figure S1B hla_dqa1-cd74-1 3432861 N/A 3432866 competitor competitor competitor unspecified role unspecified role P18573:p.[Gln249Glu;Gln257Glu] mutation causing mutation causing an interaction mutation enabling interaction mutation causing mutation causing an interaction certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3432863 unspecified role unspecified role bait bait cell lysate cell lysate p.[Ala45Gly;Tyr58Leu;Glu77Gly;Asp89Ala;His199Arg;Thr217Ile] variant variant certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-9031 human Boleth_9031, EBV transformed lymphoblastoid cell line Human 9031 Boleth_9031, EBV transformed lymphoblastoid cell line ECACC:88052031 HLA typed. N/A 3432864 unspecified role unspecified role bait bait cell lysate cell lysate p.Val73_Asp80delinsLeuPheArgArgPheArgArgPhe variant variant certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false p.[Thr49Ser;Gln57Glu;Gly63Glu;Cys70Gln;Ile129Thr;Leu178Phe;Glu183Asp;Ser185Ile;Lys197Glu] variant variant certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false p.Ser97_Leu98delinsIleVal variant variant certain certain sequence position certain certain certain sequence position certain false human-9031 human Boleth_9031, EBV transformed lymphoblastoid cell line Human 9031 Boleth_9031, EBV transformed lymphoblastoid cell line ECACC:88052031 HLA typed. N/A 3432865 unspecified role unspecified role prey prey purified purified clip_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) 3432888 3432885 physical association physical association false false false Figure S1B A peptide TPO 632–645(Y) of unknown origin and sequence also inhibited CLIP binding. 67889oyuiuylo-1 3432862 N/A 3432863 unspecified role unspecified role neutral component neutral component purified purified p.[Ala45Gly;Tyr58Leu;Glu77Gly;Asp89Ala;His199Arg;Thr217Ile] variant variant certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3432864 unspecified role unspecified role neutral component neutral component purified purified p.val73_Asp80delinsLeuPheArgArgPheArgArgPhe variant variant certain certain sequence position certain certain certain sequence position certain false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false p.[Thr49Ser;Gln57Glu;Gly63Glu;Cys70Gln;Ile129Thr;Leu178Phe;Glu183Asp;Ser185Ile;Lys197Glu] variant variant certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false p.Ser97_Leu98delinsIleVal variant variant certain certain sequence position certain certain certain sequence position certain false spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm N/A 3432866 unspecified role unspecified role neutral component neutral component purified purified P18573:p.[Gln249Glu;Gln257Glu] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Table S4 2.1 A RWork =0.217 RFree =0.248