IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ikehara-2007-1 in vitro In vitro enzymatic study enzymatic study western blot western blot Immuno blot Immuno blot Ikehara T., Ikehara S., Imamura S., Shinjo F., Yasumoto T. Interactions involving "phosphorylase A" and "phosphopeptide substrate" have not been annotated as the origin and identity/sequence of these molecules are not stated. methylesterase assay tikehara@ttc.co.jp Biochemical and biophysical research communications 2007 Only protein-protein interactions imex curation imex curation ikehara-2007-4 trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Ikehara T., Ikehara S., Imamura S., Shinjo F., Yasumoto T. Interactions involving "phosphorylase A" and "phosphopeptide substrate" have not been annotated as the origin and identity/sequence of these molecules are not stated. PP2A-dimer purification -as given in Ref 21- involved Affinity chromatography using Ni–NTA agarose followed by anti-M2 FLAG agarose. The trimer is stated to have been purified using the same method. tikehara@ttc.co.jp Biochemical and biophysical research communications 2007 Only protein-protein interactions imex curation imex curation ikehara-2007-2 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Ikehara T., Ikehara S., Imamura S., Shinjo F., Yasumoto T. Interactions involving "phosphorylase A" and "phosphopeptide substrate" have not been annotated as the origin and identity/sequence of these molecules are not stated. tikehara@ttc.co.jp Biochemical and biophysical research communications 2007 Only protein-protein interactions imex curation imex curation ikehara-2007-3 trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ikehara T., Ikehara S., Imamura S., Shinjo F., Yasumoto T. Interactions involving "phosphorylase A" and "phosphopeptide substrate" have not been annotated as the origin and identity/sequence of these molecules are not stated. PP2A-dimer purification -as given in Ref 21- involved Affinity chromatography using Ni–NTA agarose followed by anti-M2 FLAG agarose. The trimer is stated to have been purified using the same method. tikehara@ttc.co.jp Biochemical and biophysical research communications 2007 Only protein-protein interactions imex curation imex curation ppme1_human Protein phosphatase methylesterase 1 PPME1 PME1 PP2593 PRO0750 protein protein human Homo sapiens Human MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHGGGHSALSWAVFTAAIISRVQCRIVALDLRSHGETKVKNPEDLSAETMAKDVGNVVEAMYGDLPPPIMLIGHSMGGAIAVHTASSNLVPSLLGLCMIDVVEGTAMDALNSMQNFLRGRPKTFKSLENAIEWSVKSGQIRNLESARVSMVGQVKQCEGITSPEGSKSIVEGIIEEEEEDEEGSESISKRKKEDDMETKKDHPYTWRIELAKTEKYWDGWFRGLSNLFLSCPIPKLLLLAGVDRLDKDLTIGQMQGKFQMQVLPQCGHAVHEDAPDKVAEAVATFLIRHRFAEPIGGFQCVFPGC pp2aa_human Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform PPP2CA Replication protein C protein protein human Homo sapiens Human MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL 2aaa_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform PPP2R1A PP2A subunit A isoform PR65-alpha PP2A subunit A isoform R1-alpha Medium tumor antigen-associated 61 kDa protein protein protein human Homo sapiens Human MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA 2abb_human Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform PP2A subunit B isoform beta PP2A subunit B isoform B55-beta PP2A subunit B isoform PR55-beta PPP2R2B PP2A subunit B isoform R2-beta protein protein human Homo sapiens Human MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN ppme1-ppp2ca-6 3340712 N/A 3340716 enzyme enzyme neutral component neutral component purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3340717 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false leu309 omeleu L-leucine methyl ester 2-amino-4-methylpentanoic methyl ester L-leucine methyl ester MOD_RES Leucine methyl ester alpha-aminoisocaproic methyl ester methyl (2S)-2-amino-4-methylpentanoate methyl L-leucinate methyl esterified L-leucine Methyl Methylation OMeLeu certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3340718 unspecified role unspecified role ancillary ancillary purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Figure 1A ppp2r1a-ppp2r2b-1 3340712 N/A 3340716 enzyme enzyme neutral component neutral component purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 3340719 ancillary ancillary neutral component neutral component purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3340717 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false leu309 omeleu L-leucine methyl ester 2-amino-4-methylpentanoic methyl ester L-leucine methyl ester MOD_RES Leucine methyl ester alpha-aminoisocaproic methyl ester methyl (2S)-2-amino-4-methylpentanoate methyl L-leucinate methyl esterified L-leucine Methyl Methylation OMeLeu certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3340718 ancillary ancillary neutral component neutral component purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Figure 2B Methylation of Leu309 in PP2AC is unnecessary for the association and dissociation of the regulatory B subunit. ppp2r1a-ppp2ca-6 3340713 N/A 3340719 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3340717 unspecified role unspecified role prey prey purified purified leu309 omeleu L-leucine methyl ester 2-amino-4-methylpentanoic methyl ester L-leucine methyl ester MOD_RES Leucine methyl ester alpha-aminoisocaproic methyl ester methyl (2S)-2-amino-4-methylpentanoate methyl L-leucinate methyl esterified L-leucine Methyl Methylation OMeLeu certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P67775:p.Leu309Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P67775:p.Leu309del mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3340718 unspecified role unspecified role bait bait purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. association association false false false Figure 3A (Supp figure 1) Methylation of Leu309 in PP2AC is unnecessary for the association and dissociation of the regulatory B subunit. ppp2r1a-ppp2ca-7 3340713 N/A 3340717 unspecified role unspecified role prey prey purified purified leu309 omeleu L-leucine methyl ester 2-amino-4-methylpentanoic methyl ester L-leucine methyl ester MOD_RES Leucine methyl ester alpha-aminoisocaproic methyl ester methyl (2S)-2-amino-4-methylpentanoate methyl L-leucinate methyl esterified L-leucine Methyl Methylation OMeLeu certain certain sequence position certain certain certain sequence position certain false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P67775:p.Leu309Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P67775:p.Leu309del mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3340718 unspecified role unspecified role bait bait purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association false false false Figure 3A-2 (supp figure 1) Methylation of Leu309 in PP2AC is unnecessary for the association and dissociation of the regulatory B subunit. ppme1-ppp2ca-7 3340714 N/A 3340719 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 N/A 3340717 unspecified role unspecified role ancillary ancillary purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P67775:p.Leu309Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false P67775:p.Leu309del mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false leu309 omeleu L-leucine methyl ester 2-amino-4-methylpentanoic methyl ester L-leucine methyl ester MOD_RES Leucine methyl ester alpha-aminoisocaproic methyl ester methyl (2S)-2-amino-4-methylpentanoate methyl L-leucinate methyl esterified L-leucine Methyl Methylation OMeLeu certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3340718 unspecified role unspecified role bait bait purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association false false false Figure 2A, 3B The "B" (regulatory) subunit bound to methylated and demethylated PP2AD. ppme1-ppp2ca-8 3340715 N/A 3340719 unspecified role unspecified role prey prey purified purified trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3340717 unspecified role unspecified role prey prey purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false leu309 omeleu L-leucine methyl ester 2-amino-4-methylpentanoic methyl ester L-leucine methyl ester MOD_RES Leucine methyl ester alpha-aminoisocaproic methyl ester methyl (2S)-2-amino-4-methylpentanoate methyl L-leucinate methyl esterified L-leucine Methyl Methylation OMeLeu certain certain sequence position certain certain certain sequence position certain false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. N/A 3340718 unspecified role unspecified role bait bait purified purified region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. association association false false false Figure 2Bi Methylation of Leu309 in PP2AC is unnecessary for the association and dissociation of the regulatory B subunit.