IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tami-2007-1 in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection Tami C., Silberstein E., Manangeeswaran M., Freeman GJ., Umetsu SE., DeKruyff RH., Umetsu DT., Kaplan GG. The human Immunoglobulin lambda light chain has been entered as UniProt P0DOX8;however the sequence shown for this identifier is only an example of a full-length immunoglobulin lambda light chain may not be an exact match to the sequence of the protein mentioned in this publication. Perro6D cells were transfected with a human lymph node cDNA library. One clone (Perro6D-clone 1) bound specifically bound to TIM1(IgV)-Fc. Nucleotide sequence analysis of extracted DNA revealed encoded full-length human immunoglobulin heavy a1 and light lambda chains. Perro6D-clone 1 cells were stained with HAVCR1/TIM1(IgV)-Fc RPE or HAVCR1/TIM1(IgV+muc)-Fc RPE. Details of TIM1 domains and constructs used were taken from Refs 13 and 43. GK@helix.nih.gov Journal of virology 2007 imex curation Only protein-protein interactions imex curation tami-2007-2 in vitro In vitro solid phase assay solid phase assay predetermined predetermined participant predetermined Tami C., Silberstein E., Manangeeswaran M., Freeman GJ., Umetsu SE., DeKruyff RH., Umetsu DT., Kaplan GG. The human Immunoglobulin lambda light chain has been entered as UniProt P0DOX8;however the sequence shown for this identifier is only an example of a full-length immunoglobulin lambda light chain may not be an exact match to the sequence of the protein mentioned in this publication. Bead binding assay. Details of TIM1 domains and constructs used were taken from Refs 13 and 43. GK@helix.nih.gov Journal of virology 2007 imex curation Only protein-protein interactions imex curation tami-2007-3 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Tami C., Silberstein E., Manangeeswaran M., Freeman GJ., Umetsu SE., DeKruyff RH., Umetsu DT., Kaplan GG. The human Immunoglobulin lambda light chain has been entered as UniProt P0DOX8;however the sequence shown for this identifier is only an example of a full-length immunoglobulin lambda light chain may not be an exact match to the sequence of the protein mentioned in this publication. Figure 7 results not added due to unknown specificity of the IgA antibody used. Details of TIM1 domains and constructs used were taken from Refs 13 and 43. GK@helix.nih.gov Journal of virology 2007 imex curation Only protein-protein interactions imex curation igl1_human Immunoglobulin lambda-1 light chain Immunoglobulin lambda-1 light chain MCG protein protein human Homo sapiens Human QSALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKAPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS igha1_human Immunoglobulin heavy constant alpha 1 IGHA1 Ig alpha-1 chain C region Ig alpha-1 chain C region BUR Ig alpha-1 chain C region TRO protein protein human Homo sapiens Human ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDASGDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY havr1_human Hepatitis A virus cellular receptor 1 T-cell immunoglobulin and mucin domain-containing protein 1 T-cell membrane protein 1 HAVCR1 TIM1 TIMD1 KIM1 Kidney injury molecule 1 T-cell immunoglobulin mucin receptor 1 protein protein human Homo sapiens Human MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPPKVTTTPIVTTVPTVTTVRTSTTVPTTTTVPMTTVPTTTVPTTMSIPTTTTVLTTMTVSTTTSVPTTTSIPTTTSVPVTTTVSTFVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQLFLEHSLLTANTTKGIYAGVCISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD qwer3254erty-1 3432685 N/A 3432688 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed canlf-perro6d canlf- Perrot6D_dog osteosarcoma cell line Dog Canis familiaris perro6d Perro6D -dog osteosarcoma cell line https://www.lgcstandards-atcc.org/products/all/CCL-183 N/A 3432689 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed canlf-perro6d canlf- Perrot6D_dog osteosarcoma cell line Dog Canis familiaris perro6d Perro6D -dog osteosarcoma cell line https://www.lgcstandards-atcc.org/products/all/CCL-183 N/A 3432690 unspecified role unspecified role neutral component neutral component purified purified c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd_Region sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. association association false false false Figure 4B Experiments proved that IgA-lambda binds specifically to the Ig-like domain of HAVCR1/TIM1. havcr1-igha1-1 3432686 N/A 3432688 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed canlf-perro6d canlf- Perrot6D_dog osteosarcoma cell line Dog Canis familiaris perro6d Perro6D -dog osteosarcoma cell line https://www.lgcstandards-atcc.org/products/all/CCL-183 N/A 3432689 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed canlf-perro6d canlf- Perrot6D_dog osteosarcoma cell line Dog Canis familiaris perro6d Perro6D -dog osteosarcoma cell line https://www.lgcstandards-atcc.org/products/all/CCL-183 N/A 3432690 unspecified role unspecified role neutral component neutral component purified purified ecd_Region sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. association association false false false Figure 4A (2) havcr1-igha1-2 3432687 N/A 3432688 unspecified role unspecified role ancillary ancillary over-expressed over expressed level over-expressed conditioned medium conditioned medium canlf-perro6d canlf- Perrot6D_dog osteosarcoma cell line Dog Canis familiaris perro6d Perro6D -dog osteosarcoma cell line https://www.lgcstandards-atcc.org/products/all/CCL-183 N/A 3432689 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed conditioned medium conditioned medium canlf-perro6d canlf- Perrot6D_dog osteosarcoma cell line Dog Canis familiaris perro6d Perro6D -dog osteosarcoma cell line https://www.lgcstandards-atcc.org/products/all/CCL-183 N/A 3432690 unspecified role unspecified role bait bait purified purified c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd_Region sufficient to bind sufficient binding region sufficient to bind range range range range false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. association association false false false Figure 6 Experiments proved that IgA-lambda binds specifically to the Ig-like domain of HAVCR1/TIM1.