DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ san-1998-1 ecolx Escherichia coli 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined San Martin C., Radermacher M., Wolpensinger B., Engel A., Miles CS., Dixon NE., Carazo JM. DIP original experiment: DIP-263281X Structure (London, England : 1993) 1998 IMEx Three-dimensional reconstructions from cryoelectron microscopy images reveal an intimate complex between helicase DnaB and its loading partner DnaC. San Martin C., Radermacher M., Wolpensinger B., Engel A., Miles CS., Dixon NE., Carazo JM. Only protein-protein interactions imex curation san-1998-2 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined San Martin C., Radermacher M., Wolpensinger B., Engel A., Miles CS., Dixon NE., Carazo JM. DIP original experiment: DIP-263282X Structure (London, England : 1993) 1998 IMEx Three-dimensional reconstructions from cryoelectron microscopy images reveal an intimate complex between helicase DnaB and its loading partner DnaC. San Martin C., Radermacher M., Wolpensinger B., Engel A., Miles CS., Dixon NE., Carazo JM. Only protein-protein interactions imex curation san-1998-3 in vitro In vitro ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined San Martin C., Radermacher M., Wolpensinger B., Engel A., Miles CS., Dixon NE., Carazo JM. DIP original experiment: DIP-263283X Structure (London, England : 1993) 1998 IMEx Three-dimensional reconstructions from cryoelectron microscopy images reveal an intimate complex between helicase DnaB and its loading partner DnaC. San Martin C., Radermacher M., Wolpensinger B., Engel A., Miles CS., Dixon NE., Carazo JM. Only protein-protein interactions imex curation dnab_ecoli Replicative DNA helicase dnaB groP grpA b4052 JW4012 protein protein ecoli Escherichia coli (strain K12) MAGNKPFNKQQAEPRERDPQVAGLKVPPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLITLAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRERAVVREMISVANEIAEAGFDPQGRTSEDLLDLAESRVFKIAESRANKDEGPKNIADVLDATVARIEQLFQQPHDGVTGVNTGYDDLNKKTAGLQPSDLIIVAARPSMGKTTFAMNLVENAAMLQDKPVLIFSLEMPSEQIMMRSLASLSRVDQTKIRTGQLDDEDWARISGTMGILLEKRNIYIDDSSGLTPTEVRSRARRIAREHGGIGLIMIDYLQLMRVPALSDNRTLEIAEISRSLKALAKELNVPVVALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLIMFIYRDEVYHENSDLKGIAEIIIGKQRNGPIGTVRLTFNGQWSRFDNYAGPQYDDE dnac_ecoli DNA replication protein DnaC dnaC dnaD b4361 JW4325 protein protein ecoli Escherichia coli (strain K12) MKNVGDLMQRLQKMMPAHIKPAFKTGEELLAWQKEQGAIRSAALERENRAMKMQRTFNRSGIRPLHQNCSFENYRVECEGQMNALSKARQYVEEFDGNIASFIFSGKPGTGKNHLAAAICNELLLRGKSVLIITVADIMSAMKDTFRNSGTSEEQLLNDLSNVDLLVIDEIGVQTESKYEKVIINQIVDRRSSSKRPTGMLTNSNMEEMTKLLGERVMDRMRLGNSLWVIFNWDSYRSRVTGKEY dnab-8 3293629 N/A 3293632 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dnab-dnac-2 3293630 N/A 3293633 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293632 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false dnab-dnac-3 3293631 N/A 3293633 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3293632 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli direct interaction direct interaction false false false