DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ schauber-1998-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. DIP original experiment: DIP-265143X Nature 1998 IMEx Rad23 links DNA repair to the ubiquitin/proteasome pathway. Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. Only protein-protein interactions imex curation schauber-1998-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. DIP original experiment: DIP-265147X Nature 1998 IMEx Rad23 links DNA repair to the ubiquitin/proteasome pathway. Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. Only protein-protein interactions imex curation schauber-1998-3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. DIP original experiment: DIP-265145X Nature 1998 IMEx Rad23 links DNA repair to the ubiquitin/proteasome pathway. Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. Only protein-protein interactions imex curation schauber-1998-4 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. DIP original experiment: DIP-265149X Nature 1998 IMEx Rad23 links DNA repair to the ubiquitin/proteasome pathway. Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. Only protein-protein interactions imex curation schauber-1998-5 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. DIP original experiment: DIP-265144X Nature 1998 IMEx Rad23 links DNA repair to the ubiquitin/proteasome pathway. Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. Only protein-protein interactions imex curation schauber-1998-6 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down anti tag western anti tag western blot anti tag western Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. DIP original experiment: DIP-265146X Nature 1998 IMEx Rad23 links DNA repair to the ubiquitin/proteasome pathway. Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. Only protein-protein interactions imex curation schauber-1998-7 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom western blot western blot Immuno blot Immuno blot Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. DIP original experiment: DIP-265150X Nature 1998 IMEx Rad23 links DNA repair to the ubiquitin/proteasome pathway. Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. Only protein-protein interactions imex curation schauber-1998-8 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. DIP original experiment: DIP-265151X Nature 1998 IMEx Rad23 links DNA repair to the ubiquitin/proteasome pathway. Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. Only protein-protein interactions imex curation schauber-1998-9 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. DIP original experiment: DIP-265148X Nature 1998 IMEx Rad23 links DNA repair to the ubiquitin/proteasome pathway. Schauber C., Chen L., Tongaonkar P., Vega I., Lambertson D., Potts W., Madura K. Only protein-protein interactions imex curation prs7_yeast 26S proteasome regulatory subunit 7 homolog YKL145W RPT1 CIM5 YTA3 Protein CIM5 Tat-binding homolog 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPPKEDWEKYKAPLEDDDKKPDDDKIVPLTEGDIQVLKSYGAAPYAAKLKQTENDLKDIEARIKEKAGVKESDTGLAPSHLWDIMGDRQRLGEEHPLQVARCTKIIKGNGESDETTTDNNNSGNSNSNSNQQSTDADEDDEDAKYVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYMQYN 8454BBC9D549EC5C prs8_yeast 26S proteasome regulatory subunit 8 homolog TBPY TBY1 YGL048C RPT6 CIM3 CRL3 SUG1 Protein SUG1 Protein CIM3 Tat-binding protein TBY1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTAAVTSSNIVLETHESGIKPYFEQKIQETELKIRSKTENVRRLEAQRNALNDKVRFIKDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETAISVAKLFK 9C59E92A0794F60F rad23_yeast UV excision repair protein RAD23 SYGP-ORF29 YEL037C RAD23 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKSTKTKVTEPPIAPESATTPGRENSTEASPSTDASAAPAATAPEGSQPQEEQTATTERTESASTPGFVVGTERNETIERIMEMGYQREEVERALRAAFNNPDRAVEYLLMGIPENLRQPEPQQQTAAAAEQPSTAATTAEQPAEDDLFAQAAQGGNASSGALGTTGGATDAAQGGPPGSIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEAVGDNMQDVMEGADDMVEGEDIEVTGEAAAAGLGQGEGEGSFQVDYTPEDDQAISRLCELGFERDLVIQVYFACDKNEEAAANILFSDHAD B3F0436DAB60B833 psb4_yeast Proteasome subunit beta type-4 PRE1 YER012W Proteasome component C11 Macropain subunit C11 Proteinase YSCE subunit 11 Multicatalytic endopeptidase complex subunit C11 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDDFQAQ ED43D319A5895B40 rad4_yeast DNA repair protein RAD4 YER162C RAD4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MNEDLPKEYFELIRKALNEKEAEKAPLSRRRRVRRKNQPLPDAKKKFKTGLNELPRESVVTVNLDSSDDGVVTVPTDDSVEEIQSSEEDYDSEEFEDVTDGNEVAGVEDISVEIKPSSKRNSDARRTSRNVCSNEERKRRKYFHMLYLVCLMVHGFIRNEWINSKRLSRKLSNLVPEKVFELLHPQKDEELPLRSTRKLLDGLKKCMELWQKHWKITKKYDNVGLYMRTWKEIEMSANNKRKFKTLKRSDFLRAVSKGHGDPDISVQGFVAMLRACNVNARLIMSCQPPDFTNMKIDTSLNGNNAYKDMVKYPIFWCEVWDKFSKKWITVDPVNLKTIEQVRLHSKLAPKGVACCERNMLRYVIAYDRKYGCRDVTRRYAQWMNSKVRKRRITKDDFGEKWFRKVITALHHRKRTKIDDYEDQYFFQRDESEGIPDSVQDLKNHPYYVLEQDIKQTQIVKPGCKECGYLKVHGKVGKVLKVYAKRDIADLKSARQWYMNGRILKTGSRCKKVIKRTVGRPKGEAEEEDERLYSFEDTELYIPPLASASGEITKNTFGNIEVFAPTMIPGNCCLVENPVAIKAARFLGVEFAPAVTSFKFERGSTVKPVLSGIVVAKWLREAIETAIDGIEFIQEDDNRKEHLLGALESWNTLLLKLRIRSKLNSTYGKIAEEEPNVTKEQNIADNHDNTETFMGGGFLPGIANHEARPYSEPSEPEDSLDYVSVDKAEESATDDDVGEDYSDFMKELEMSEESD 788D3B6F580D2BF8 psb2_yeast Proteasome subunit beta type-2 PUP1 YOR157C Macropain subunit PUP1 Proteinase YSCE subunit PUP1 Multicatalytic endopeptidase complex subunit PUP1 Proteasome component PUP1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAGLSFDNYQRNNFLAENSHTQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICDIQEEQVDITA 13A8F2B75584539A prs7_human 26S proteasome regulatory subunit 7 PSMC2 MSS1 Proteasome 26S subunit ATPase 2 Protein MSS1 26S proteasome AAA-ATPase subunit RPT1 protein protein human Homo sapiens Human MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSATPRYMTYN p54727-1 UV excision repair protein RAD23 homolog B RAD23B XP-C repair-complementing complex 58 kDa protein protein protein human Homo sapiens Human MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVTKPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPASAAKQEKPAEKPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED rad23p-cim3p-1 3293542 N/A 3293551 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293552 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293553 unspecified role unspecified role bait bait 1-77 Binding Region 1-77 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false rad23p-pre1p-1 3293543 N/A 3293554 unspecified role unspecified role prey prey FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293553 unspecified role unspecified role bait bait 1-77 Binding Region 1-77 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rad23p-cim3p-2 3293544 N/A 3293551 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293552 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293553 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false rad23p-rad4p-1 3293545 N/A 3293555 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293553 unspecified role unspecified role bait bait 78-398 Binding Region 78-398 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rad23p-cim3p-3 3293546 N/A 3293551 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293552 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293553 unspecified role unspecified role bait bait FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast association association false false false rad23p-pup1p-1 3293547 N/A 3293556 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293553 unspecified role unspecified role bait bait 1-77 Binding Region 1-77 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false cim5p-rad23p-1 3293548 N/A 3293551 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293555 unspecified role unspecified role unspecified role unspecified role HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293553 unspecified role unspecified role unspecified role unspecified role yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false rad23b-psmc2-1 3293549 N/A 3293557 unspecified role unspecified role prey prey human Homo sapiens Human N/A 3293558 unspecified role unspecified role bait bait 1-79 Binding Region 1-79 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false GST Tag GST Tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag predetermined featur predetermined feature predetermined featur n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false pre1p-rad23p-1 3293550 N/A 3293554 unspecified role unspecified role bait bait FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3293553 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false