DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ tan-1998-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Tan S., Richmond TJ. DIP original experiment: DIP-265142X Nature 1998 IMEx Crystal structure of the yeast MATalpha2/MCM1/DNA ternary complex. Tan S., Richmond TJ. Only protein-protein interactions imex curation mtal2_yeast Mating-type protein ALPHA2 MATALPHA2 ALPHA-2 MAT2A MATAL2 YCR039C YCR39C Alpha-2 repressor protein protein yeast Saccharomyces cerevisiae Baker's yeast MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLLSGEPLAKKKE This sequence has been withdrawn from Uniprot. 30CD6A486D7D76CE mcm1_yeast Pheromone receptor transcription factor MCM1 FUN80 YMR043W YM9532.08 GRM/PRTF protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDIEEGTPTNNGQQKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDEEEDEEEDGDDDDDDDDDGNDMQRQQPQQQQPQQQQQVLNAHANSLGHLNQDQVPAGALKQEVKSQLLGGANPNQNSMIQQQQHHTQNSQPQQQQQQQPQQQMSQQQMSQHPRPQQGIPHPQQSQPQQQQQQQQQLQQQQQQQQQQPLTGIHQPHQQAFANAASPYLNAEQNAAYQQYFQEPQQGQY matalpha2-mcm1-2 3293534 N/A 3293535 unspecified role unspecified role unspecified role unspecified role 103-189 Binding Region 103-189 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3293536 unspecified role unspecified role unspecified role unspecified role 1-100 Binding Region 1-100 Binding Region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false