DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ zeng-1997-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Zeng Z., Castaño AR., Segelke BW., Stura EA., Peterson PA., Wilson IA. DIP original experiment: DIP-268343X Science (New York, N.Y.) 1997 IMEx Crystal structure of mouse CD1: An MHC-like fold with a large hydrophobic binding groove. Zeng Z., Castaño AR., Segelke BW., Stura EA., Peterson PA., Wilson IA. Only protein-protein interactions imex curation b2mg_mouse Beta-2-microglobulin B2m protein protein mouse Mus musculus Mouse MARSVTLVFLVLVSLTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM cd1d1_mouse Antigen-presenting glycoprotein CD1d1 Cd1d1 Cd1.1 protein protein mouse Mus musculus Mouse MRYLPWLLLWAFLQVWGQSEAQQKNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSADGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWDARQAPVGLIVFIVLIMLVVVGAVVYYIWRRRSAYQDIR b2m-cd1d1-1 3293289 N/A 3293290 unspecified role unspecified role unspecified role unspecified role 21-119 binding region 21-119 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly N/A 3293291 unspecified role unspecified role unspecified role unspecified role 22-336 binding region 22-336 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false drome Drosophila melanogaster (Fruit fly) Fruit fly direct interaction direct interaction false false false