DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ harrison-1997-1 in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Harrison CJ., Hayer-Hartl M., Di Liberto M., Hartl F., Kuriyan J. DIP original experiment: DIP-268322X Science (New York, N.Y.) 1997 IMEx Crystal structure of the nucleotide exchange factor GrpE bound to the ATPase domain of the molecular chaperone DnaK. Harrison CJ., Hayer-Hartl M., Di Liberto M., Hartl F., Kuriyan J. Only protein-protein interactions imex curation harrison-1997-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Harrison CJ., Hayer-Hartl M., Di Liberto M., Hartl F., Kuriyan J. DIP original experiment: DIP-268323X Science (New York, N.Y.) 1997 IMEx Crystal structure of the nucleotide exchange factor GrpE bound to the ATPase domain of the molecular chaperone DnaK. Harrison CJ., Hayer-Hartl M., Di Liberto M., Hartl F., Kuriyan J. Only protein-protein interactions imex curation grpe_ecoli Protein GrpE b2614 grpE HSP-70 cofactor Heat shock protein B25.3 HSP24 JW2594 protein protein ecoli Escherichia coli (strain K12) MSSKEQKTPEGQAPEEIIMDQHEEIEAVEPEASAEQVDPRDEKVANLEAQLAEAQTRERDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAKA dnak_ecoli Chaperone protein DnaK dnaK groP grpF seg b0014 Heat shock protein 70 Heat shock 70 kDa protein HSP70 JW0013 protein protein ecoli Escherichia coli (strain K12) MGKIIGIDLGTTNSCVAIMDGTTPRVLENAEGDRTTPSIIAYTQDGETLVGQPAKRQAVTNPQNTLFAIKRLIGRRFQDEEVQRDVSIMPFKIIAADNGDAWVEVKGQKMAPPQISAEVLKKMKKTAEDYLGEPVTEAVITVPAYFNDAQRQATKDAGRIAGLEVKRIINEPTAAALAYGLDKGTGNRTIAVYDLGGGTFDISIIEIDEVDGEKTFEVLATNGDTHLGGEDFDSRLINYLVEEFKKDQGIDLRNDPLAMQRLKEAAEKAKIELSSAQQTDVNLPYITADATGPKHMNIKVTRAKLESLVEDLVNRSIEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFFGKEPRKDVNPDEAVAIGAAVQGGVLTGDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVKDKK dnak-grpe-2 3293081 N/A 3293083 unspecified role unspecified role unspecified role unspecified role 34-197 binding region 34-197 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli N/A 3293084 unspecified role unspecified role unspecified role unspecified role 1-138 binding region 1-138 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli direct interaction direct interaction false false false grpe-dnak-3 3293082 N/A 3293083 unspecified role unspecified role bait bait ecolx Escherichia coli N/A 3293084 unspecified role unspecified role prey prey ecolx Escherichia coli direct interaction direct interaction false false false