DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ chinnaiyan-1997-1 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268302X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-2 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268310X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-3 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268306X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-4 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268303X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-5 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268311X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-6 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268313X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-7 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268307X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-8 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268312X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-9 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268304X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-10 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268308X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-11 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268314X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-12 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268305X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-13 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268316X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-14 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268315X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation chinnaiyan-1997-15 human Homo sapiens Human anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. DIP original experiment: DIP-268309X Science (New York, N.Y.) 1997 IMEx Interaction of CED-4 with CED-3 and CED-9: a molecular framework for cell death. Chinnaiyan AM., O'Rourke K., Lane BR., Dixit VM. Only protein-protein interactions imex curation ced9_caeel Apoptosis regulator ced-9 Cell death protein 9 ced-9 T07C4.8 protein protein caeel Caenorhabditis elegans MTRCTADNSLTNPAYRRRTMATGEMKEFLGIKGTEPTDFGINSDAQDLPSPSRQASTRRMSIGESIDGKINDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMGTIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEAEKVGRRKQNRRWSMIGAGVTAGAIGIVGVVVCGRMMFSLK p30429-2 Cell death protein 4 Short C35D10.9 ced-4 protein protein caeel Caenorhabditis elegans MLCEIECRALSTAHTRLIHDFEPRDALTYLEGKNIFTEDHSELISKMSTRLERIANFLRIYRRQASELGPLIDFFNYNNQSHLADFLEDYIDFAINEPDLLRPVVIAPQFSRQMLDRKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIPVKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQTIANGISILEQRLLEIGNNNVSVPERHIPSHFQKFRRSSASEMYPKTTEETVIRPEDFPKFMQLHQKFYDSLKNFACC Major transcript. bik_human Bcl-2-interacting killer Apoptosis inducer NBK BP4 BIP1 BIK NBK protein protein human Homo sapiens Human MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK ced3_caeel Cell death protein 3 ced-3 Caspase ced-3 C48D1.2 protein protein caeel Caenorhabditis elegans MMRQDRRSLLERNIMMFSSHLKVDEILEVLIAKQVLNSDNGDMINSCGTVREKRREIVKAVQRRGDVAFDAFYDALRSTGHEGLAEVLEPLARSVDSNAVEFECPMSPASHRRSRALSPAGYTSPTRVHRDSVSSVSSFTSYQDIYSRARSRSRSRALHSSDRHNYSSPPVNAFPSQPSSANSSFTGCSSLGYSSSRNRSFSKASGPTQYIFHEEDMNFVDAPTISRVFDEKTMYRNFSSPRGMCLIINNEHFEQMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLTIRDFAKHESHGDSAILVILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQACRGERRDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQQVWRKKPSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLTEVNKKVACGFQTSQGSNILKQMPEMTSRLLKKFYFWPEARNSAV casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS ced_4-ced_9-1 3292921 N/A 3292936 unspecified role unspecified role prey prey AU1 Tag AU1 Tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3292937 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false bcl2l1-bik-6 3292922 N/A 3292938 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3292939 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false ced_4-bcl2l1-1 3292923 N/A 3292939 unspecified role unspecified role prey prey Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q07817-1:p.Gly134_Asn136delinsAlaIleLeu 134-136 mutation mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3292937 unspecified role unspecified role bait bait HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false ced_9-ced_4-3 3292924 N/A 3292936 unspecified role unspecified role bait bait AU1 Tag AU1 Tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false 160-280 binding region 160-280 binding region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3292937 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false ced_3-ced_4-8 3292925 N/A 3292940 unspecified role unspecified role bait bait FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3292937 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false casp8-ced_4-1 3292926 N/A 3292941 unspecified role unspecified role bait bait FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3292937 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false bcl2l1-bax-10 3292927 N/A 3292942 unspecified role unspecified role prey prey FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3292939 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false ced_3-ced_4-9 3292928 N/A 3292940 unspecified role unspecified role bait bait FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3292937 unspecified role unspecified role prey prey Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 1-301 binding region 1-301 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human physical association physical association false false false ced_9-ced_4-4 3292929 N/A 3292936 unspecified role unspecified role bait bait AU1 Tag AU1 Tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false 160-280 binding region 160-280 binding region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3292937 unspecified role unspecified role prey prey Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false bcl2l1-bak1-5 3292930 N/A 3292943 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3292939 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false ced_3-ced_4-10 3292931 N/A 3292940 unspecified role unspecified role bait bait FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3292936 unspecified role unspecified role prey prey AU1 Tag AU1 Tag au1 tag au1 tag DTYRYI epitope tag DTYRYI epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3292937 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human association association false false false bcl2l1-ced_4-1 3292932 N/A 3292939 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Q07817-1:p.Gly134_Asn136delinsAlaIleLeu 134-136 mutation mutation disrupting mutation disrupting interaction mutation disrupting substitut analysis substitution analysis substitut analysis certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human N/A 3292937 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false ced_3-ced_4-11 3292933 N/A 3292940 unspecified role unspecified role bait bait 1-130 binding region 1-130 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 99-502 binding region 99-502 binding region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3292937 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human Homo sapiens Human physical association physical association false false false casp8-bcl2l1-1 3292934 N/A 3292941 unspecified role unspecified role bait bait FLAG Tag FLAG Tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human N/A 3292939 unspecified role unspecified role prey prey Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false bcl2l1-bax-11 3292935 N/A 3292942 unspecified role unspecified role prey prey HA Tag HA Tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range false human Homo sapiens Human N/A 3292939 unspecified role unspecified role bait bait Myc Tag Myc Tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag predetermined featur predetermined feature predetermined featur c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human Homo sapiens Human physical association physical association false false false