DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ wu-1994-1 crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Wu H., Lustbader JW., Liu Y., Canfield RE., Hendrickson WA. DIP original experiment: DIP-263069X Structure (London, England : 1993) 1994 IMEx Structure of human chorionic gonadotropin at 2.6 A resolution from MAD analysis of the selenomethionyl protein. Wu H., Lustbader JW., Liu Y., Canfield RE., Hendrickson WA. Only protein-protein interactions imex curation cgb3_human Choriogonadotropin subunit beta 3 CGB5 CGB8 CGB3 CGB Choriogonadotropin subunit beta Chorionic gonadotropin chain beta protein protein human Homo sapiens Human MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ mint Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy glha_human Glycoprotein hormones alpha chain Anterior pituitary glycoprotein hormones common subunit alpha Follitropin alpha chain Follicle-stimulating hormone alpha chain Lutropin alpha chain Luteinizing hormone alpha chain Thyrotropin alpha chain Thyroid-stimulating hormone alpha chain Choriogonadotropin alpha chain Chorionic gonadotrophin subunit alpha CGA protein protein human Homo sapiens Human MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS cga-cgb-1 3292664 N/A 3292665 unspecified role unspecified role unspecified role unspecified role 21-165 binding region 21-165 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster N/A 3292666 unspecified role unspecified role unspecified role unspecified role 25-116 binding region 25-116 binding region sufficient to bind sufficient binding region sufficient to bind predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster direct interaction direct interaction false false false