DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ simon-1995-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Simon MN., De Virgilio C., Souza B., Pringle JR., Abo A., Reed SI. DIP original experiment: DIP-266999X Nature 1995 IMEx Role for the Rho-family GTPase Cdc42 in yeast mating-pheromone signal pathway. Simon MN., De Virgilio C., Souza B., Pringle JR., Abo A., Reed SI. Only protein-protein interactions imex curation simon-1995-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Simon MN., De Virgilio C., Souza B., Pringle JR., Abo A., Reed SI. DIP original experiment: DIP-267000X Nature 1995 IMEx Role for the Rho-family GTPase Cdc42 in yeast mating-pheromone signal pathway. Simon MN., De Virgilio C., Souza B., Pringle JR., Abo A., Reed SI. Only protein-protein interactions imex curation cdc42_yeast Cell division control protein 42 CDC42 SRO2 YLR229C L8083.13 Suppressor of RHO3 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKKCAIL 30BD644BA9836B2C ste20_yeast Serine/threonine-protein kinase STE20 STE20 YHL007C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSNDPSAVSELPDKDSLDNGISNDNERAMGGNGDGGDGLRLPRTTGTLNVNALQKGTNAAHEAGGYKSMDPAKNAETTNDDDNNVVSLDDPIQFTRVSSSSVISGMSSSMSPHSNIDETKSLEAVTPNINTSNITPDHSADNTFSTINASESDHQFNDTLLSKLSLTDSTETIENNATVKHQQPVASSTVNSNKSSTDIRRATPVSTPVISKPSMTTTPRQINSASHSLSNPKHKQHKPKVKPSKPEAKSKPVSVKKSFPSKNPLKNSSPPKKQTEKSYYSSSSKKRKSGSNSGTLRMKDVFTSFVQNIKRNSQDDKRASSSSNNSSSSSITTALRISTPYNAKHIHHVGVDSKTGEYTGLPEEWEKLLTSSGISKREQQQNMQAVMDIVKFYQDVTETNGEDKMFKTFNTTTGLPGSPQVSTPPANSFNKFPPSTSDSHNYGSRTGTPMSNHVMSPTLNTDSSSANGKFIPSRPAPKPPSSASASAPIIKSPVMNSAANVSPLKQTHAPTTPNRTSPNRSSISRNATLKKEEQPLPPIPPTKSKTSPIISTAHTPQQVAQSPKAPAQETVTTPTSKPAQARSLSKELNEKKREERERRKKQLYAKLNEICSDGDPSTKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITEIAEANSSLAPLVKLARLKKVAENMDADEDNDDDNDNEHINKTNNCDDNNDSKETVNLDVTEDDKQK 69C1C12F5B87733C ste20p-cdc42p-1 3292336 N/A 3292338 unspecified role unspecified role prey prey P19073:p.Cys188Ser C188S mutation mutation increasing mutation increasing interaction mutation increasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false P19073:p.[Gly12Val;Cys188Ser] G12V/C188S mutation mutation increasing mutation increasing interaction mutation increasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P19073:p.[Gln61Leu;Cys188Ser] Q61L/C188S mutation mutation increasing mutation increasing interaction mutation increasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3292339 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false cdc42p-ste20p-1 3292337 N/A 3292338 unspecified role unspecified role bait bait P19073:p.Cys188Ser C188S mutation mutation increasing mutation increasing interaction mutation increasing predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3292339 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false