IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ning-2016-2 human-hep2 Homo sapiens hep2 hep2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ning R., Zhan Y., He S., Hu J., Zhu Z., Hu G., Yan B., Yang J., Liu W. DEC1 was determined to be of Human origin from reference 12 (Mao et al.,2012); notably the 412 aa length of molecule as shown in Fig 3B, and mutant mapping - R58P, P56A (the latter from reference 19 of this publication-Li et al., 2003 pmid:12624110). jianyang@njmu.edu.cn,liuweicp@njmu.edu.cn,liuweicp@njmu.edu.cn Frontiers in pharmacology 2016 imex curation Only protein-protein interactions imex curation ning-2016-1 human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Ning R., Zhan Y., He S., Hu J., Zhu Z., Hu G., Yan B., Yang J., Liu W. Cross-linker is Formaldehyde DEC1 was determined to be of Human origin from reference 12 (Mao et al.,2012); notably the 412 aa length of molecule as shown in Fig 3B, and mutant mapping - R58P, P56A (the latter from reference 19 of this publication-Li et al., 2003 pmid:12624110). jianyang@njmu.edu.cn,liuweicp@njmu.edu.cn,liuweicp@njmu.edu.cn Frontiers in pharmacology 2016 imex curation Only protein-protein interactions imex curation ning-2016-3 human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ning R., Zhan Y., He S., Hu J., Zhu Z., Hu G., Yan B., Yang J., Liu W. DEC1 was determined to be of Human origin from reference 12 (Mao et al.,2012); notably the 412 aa length of molecule as shown in Fig 3B, and mutant mapping - R58P, P56A (the latter from reference 19 of this publication-Li et al., 2003 pmid:12624110). jianyang@njmu.edu.cn,liuweicp@njmu.edu.cn,liuweicp@njmu.edu.cn Frontiers in pharmacology 2016 imex curation Only protein-protein interactions imex curation rxra_human Retinoic acid receptor RXR-alpha RXRA NR2B1 Retinoid X receptor alpha Nuclear receptor subfamily 2 group B member 1 protein protein human Homo sapiens Human MDTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGFSTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVERILEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT bhe40_human Class E basic helix-loop-helix protein 40 BHLHE40 Differentially expressed in chondrocytes protein 1 Enhancer-of-split and hairy-related protein 2 Stimulated by retinoic acid gene 13 protein BHLHB2 DEC1 SHARP2 STRA13 Class B basic helix-loop-helix protein 2 protein protein human Homo sapiens Human MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD bhlhe40-rxra-1 3325642 N/A 3325645 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325646 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Figure 8C IL6 bhlhe40-rxra-2 3325642 N/A 3325645 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325646 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 8D 23423wrer-1 3325643 N/A 3325646 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 3325645 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association false false false Figure 8 A/B 231eqdaf-1 3325644 N/A 3325645 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 3325646 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Figure 8E