IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ssadh-2017-2 human-cama-1 Human CAMA-1 Breast adenocarcinoma, derived from metastatic site: pleural effusion cama-1 Human CAMA-1 Breast adenocarcinoma, derived from metastatic site: pleural effusion http://www.lgcstandards-atcc.org/products/all/HTB-21.aspx?gclid=Cj0KEQjw6deeBRCswoauquC8haUBEiQAdq5zh_8UuH2LvwJZhI8PgJMkbdeRwWUGeOBeWeE8leDHvmUaAqa18P8HAQ&geo_country=gb ATCC HTB-21 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer Oncotarget 2017 imex curation Only protein-protein interactions imex curation ssadh-2017-6 human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer Oncotarget 2017 imex curation Only protein-protein interactions imex curation ssadh-2017-7 human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer Oncotarget 2017 imex curation Only protein-protein interactions imex curation ssadh-2017-1 human-cama-1 Human CAMA-1 Breast adenocarcinoma, derived from metastatic site: pleural effusion cama-1 Human CAMA-1 Breast adenocarcinoma, derived from metastatic site: pleural effusion http://www.lgcstandards-atcc.org/products/all/HTB-21.aspx?gclid=Cj0KEQjw6deeBRCswoauquC8haUBEiQAdq5zh_8UuH2LvwJZhI8PgJMkbdeRwWUGeOBeWeE8leDHvmUaAqa18P8HAQ&geo_country=gb ATCC HTB-21 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer Oncotarget 2017 imex curation Only protein-protein interactions imex curation ssadh-2017-4 human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer Oncotarget 2017 imex curation Only protein-protein interactions imex curation ssadh-2017-5 human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ssadh HA., Spencer PS., Alabdulmenaim W., Alghamdi R., Madar IH., Miranda-Sayago JM., Fernández N. Cancer - Interactions investigated in the context of cancer Oncotarget 2017 imex curation Only protein-protein interactions imex curation hg2a_human HLA class II histocompatibility antigen gamma chain DHLAG HLA-DR antigens-associated invariant chain Ia antigen-associated invariant chain CD74 protein protein human Homo sapiens Human MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM cd44_human CD44 antigen Epican CDw44 Phagocytic glycoprotein I Extracellular matrix receptor III HUTCH-I Phagocytic glycoprotein 1 GP90 lymphocyte homing/adhesion receptor Hermes antigen Hyaluronate receptor Heparan sulfate proteoglycan CD44 LHR MDU2 MDU3 MIC4 protein protein human Homo sapiens Human MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV q3t4twrt-1 3325739 N/A 3325745 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325746 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Figure 6D cd44-cd74-4 3325739 N/A 3325745 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325746 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Figure 6C It is stated that CD74 interacts with both CD44s (standard) and CD44v (variant) isoform(s). (Two bands, of molecular weights of 80 and 90 kDa, are visible). cd74-cd44-1 3325740 N/A 3325745 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325746 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Figure 6C cd44-cd74-6 3325740 N/A 3325745 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325746 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Figure 6D cd44-cd74-5 3325741 N/A 3325745 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325746 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Figure 6D cd74-cd44-2 3325741 N/A 3325745 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3325746 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Figure 6C cd44-cd74-1 3325742 N/A 3325746 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 3325745 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false Figure 5A cd44-cd74-2 3325743 N/A 3325746 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 3325745 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false Figure 5B cd44-cd74-3 3325744 N/A 3325745 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 3325746 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false Figure 5C