IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ mehla-2017-1 yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mehla J., Dedrick RM., Caufield JH., Wagemans J., Sakhawalkar N., Johnson A., Hatfull GF., Uetz P. 2017-11-14: Submitted by P Uetz, Center for the Study of Biological Complexity, Virginia Commonwealth University, USA. Baits were screened against a custom-made M. smegmatis genomic library as described in the Methods. Approximately eight positive clones for each bait (Giles protein) were selected and sequenced to identify interacting prey partners from the host, except for baits gp54, gp56 and gp64, for which 12�16 clones were sequenced each. Positive clones were then retested using an array-based Y2H screen (Fig. 1B ), and a total of 78 positive clones were sequenced. After removing redundant sequences, we identified 59 Giles-host PPIs and these were retested in an independent Y2H experiment using freshly prepared clones for the host prey proteins (Fig. 1B); the sequences of the host proteins (interactors) are shown in Table S1. The reproducible interactions from the re-test screens were used to construct a Giles-host network of 25 reproducible interactions (Fig. 2). peter@uetz.us,uetz@vcu.edu,jitender@vcu.edu peter@uetz.us A random genomic fragment library from M. smegmatis mc2155 was used Scientific reports 2017 Only protein-protein interactions imex curation imex curation mehla-2017-2 yeast Saccharomyces cerevisiae Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Mehla J., Dedrick RM., Caufield JH., Wagemans J., Sakhawalkar N., Johnson A., Hatfull GF., Uetz P. 2017-11-14: Submitted by P Uetz, Center for the Study of Biological Complexity, Virginia Commonwealth University, USA. Baits were screened against a custom-made M. smegmatis genomic library as described in the Methods. Approximately eight positive clones for each bait (Giles protein) were selected and sequenced to identify interacting prey partners from the host, except for baits gp54, gp56 and gp64, for which 12�16 clones were sequenced each. Positive clones were then retested using an array-based Y2H screen (Fig. 1B ), and a total of 78 positive clones were sequenced. After removing redundant sequences, we identified 59 Giles-host PPIs and these were retested in an independent Y2H experiment using freshly prepared clones for the host prey proteins (Fig. 1B); the sequences of the host proteins (interactors) are shown in Table S1. The reproducible interactions from the re-test screens were used to construct a Giles-host network of 25 reproducible interactions (Fig. 2). peter@uetz.us,uetz@vcu.edu,jitender@vcu.edu peter@uetz.us Scientific reports 2017 Only protein-protein interactions imex curation imex curation a0qt01_mycs2 MSMEG_1662 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MTTADITQTAPTDLGAKANRHLWGHFARHGDGITPPIITRGEGVKIFDDSGKSYIDGLSGLFVVQVGHGRKELAEAAAKQAEKLSFFPLWSYATPPAIELAERVASFAPGDLNRVFFTTGGGEAVESAWKLAKQYFKLTGKPGKHKVVSRSIAYHGTPQGALAITGIPAFKAPFEPLTPGGFRAPNTNFYRAPAEYAHDEKAFGRYCADRIAEAIEFEGPDTVAAVFLEPVQNAGGCFPPPPGYFERVREICDEYDVLLVSDEVICAYGRIGSMFACNDFGYVPDIITSAKGLTSGYSPLGAMVASDRLFEPFNDGKTVFGHGYTFGGHPVSAAVAMANLDIFEREGINDHVKTMAPAFRATLEKLYDLPIVGDVRGEGFFYGIELVKDKTTKETFNDEESERLLRGFLTPALWEAGLYCRADDRGDPVVQLAPPLISGQAEFDAIYDILHNVLTEAGNRL a8wa05_9caud 17 Giles_17 protein protein mycobacterium phage giles Mycobacterium phage Giles MPVEVTRSARALEATGAAEVTFDFRGTAVTIPRPLEAWPLDDIRAGRSGRALKALLRGQRPPMRTQSDALELSIRMADACGVTPLPESTDDVRVMFGAVPTLLRLLDNHGDDIEADLRRFYGVDMRGLFTGELTLRQLWAFVRRIPADSAVLTARNGGRPPWTRAEIIAARQWEAWVRKPYDGRPASPEEIEAWRKKQAAVAATNDRLAEREAYYASGQNMRDAGIDTAGQQFDTPGHERPPQEHQPSENDPVARALAVAKRNATRSRTNRNTNGRTADGQPQPGFRNGRWDNAGTSW a0r4b7_mycs2 Phosphate-specific transport system accessory protein PhoU phoU MSMEG_5776 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MRIQYHEQLASLNDQLGAMCELAGTAMERATQSLLQADLVLAEQVISDHEKMTTLSAQAEESAFVLLALQAPVAGDLRTVVSAIQIIADVDRMGALALHVAKIARRRHPQHALPEEVNGYFAEMGRVAVELGHAAREVLITRDPEKAARIQEEDDAMDDLHGHLFTVLMDREWKHGVMAAVDVTLLSRFYERFADHAVEVARRVIFQVTGNYPDGDKVTTQQ a0qtx7_mycs2 MSMEG_2001 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MSHLRGRSFGLRRVVWIGIWISIFQQLNGINIIFYYSTTLWQSVGFSESDSLLSSVITSAIFVVVTLVAIAVVDKIGRKPLLIAGGVGMAAMLAVMGLCFAAAVEAGGAVTLPGSYGPIALVAANLFVVAFGVSWGPVTWVMLGEIFPNSYRGPALAVAVAVQWIANFVVTVTFPPFAALSLPLSYCFYSACALLSALFVLRFVRETKGRELEEMDDIAD a8wa17_9caud Integrase 29 Giles_29 protein protein mycobacterium phage giles Mycobacterium phage Giles MGRRGNREGTYRHRPDGRWEARLLYDDPVTGERRRASFYGKTKTAVRAKMREAIDRLDADAPVRDAAVTVADWMRRWCTTTLLVSGRADSTKSLYGTLSRQYVEPAPFGAIRLDRLRTSDVEALVLRLQQATRPGRDGTPVRAVADSTIRSTYTVLRQALDGAVRDGLMARNPAAAMKRPGLSRPEVRRINDAQLADLLAATAGSRYHRALLLIAATGLRAGEALALRWDAVDLDAGSLRVVATVGRVERRLRLTTPKTERSRRTVPLTPDMVSMLRRHRADQLAERLRAANVWEDHGLVFPSAFGRPVDPRNLLRVVEQAAAQVGLEGVGVHTLRHAAAVAMLEAGIHIRAVADILGHSSVAVTGDIYGHTSDATARAAVDVLSARLRIADGSGQS rl23_mycs2 50S ribosomal protein L23 rplW MSMEG_1438 MSMEI_1402 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MATITDPRDIILAPVISEKSYGLIEDNVYTFVVHPDSNKTQIKIAIEKIFDVKVDSVNTANRQGKRKRTRTGFGKRKSTKRAIVKLAAGSKPIDLFGAPA a0r3s1_mycs2 MSMEG_5574 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MKRLRRLAACIAAAGLTATAGCAGAGTLGATDQTVTIAMVSNSQMTDARELSSRFEAENPDIKLRFVTLSENQARAKITASTAMGGGEFDVVMISNYETPQWAENGWLVDLSDYARNTPGYDEDDFIPSLKDSLSYQGDMYSVPFYGESSFLMYRKDLFEQAGIEMPRTPTWQQVADAAAELNGPDMVGICLRGKPGWGEVLAPLDTVINTFGGRWFDMDWNAQLTSPEVRKAVQFYVDTVREYGEPGASAAGFGECATQFAQGRAAMWYDATSAVSTVEDPASSNVVGKVGYAMAPTMEKPNSGWLYTWALGIPKSSDKPDAAWKFISWMTDKDYIHLVGEELGWARVPPGSRLSTYEIPEYKEASAAFGQVTLDSIEGADPAKPTVQPVPYTGVQFLAIPEFQDLGTRVSQQISAAIAGQKSVDEALEQAQKYAEVVGRSYQEKP a8wa19_9caud 31 Giles_31 protein protein mycobacterium phage giles Mycobacterium phage Giles MPVYAIQSGTVIYAGAASGYGGPDPAGWLVIDSDDAEGGGCLEYGHIVREVNRGDHVTAGQRIGHINPNNRTNGGVAPHLHVTDWPHAYGQGSRQNVMARLSGAREPEAQAAPTPTEQGTVVGDPVWLADVVRPTVAKFAEYPGWRNRGHGDFKDIRGVMVHHTGGPASAASIANGRPDLAGPLAQLHISRDGTVTVVAVGVAWHAGAGSYPWLPTNMGNWHLIGIECEWPYGEPGINERNAYTVRWRDPEIIALRNTCAAILLRLGLGVDRLIGHKDYAGRAQGKWDPGNMSMDWLRGEVRKDMDGFVFPGEDIVNVTPPPVPAPVPAPPATANVLLHRGMSGPNVVKLQTTLRRWYSKLAVDGDFGPHTEACVRDRQRIYGLDVDGIVGPLTAAKIGLVL a0qu44_mycs2 MSMEG_2071 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MASGELGSKGRQTRTAIELAARKLFAERGFHGTTLADITSAAGKSPAVFYRYFTDKEDLLAALAESFLHDVVEPSGLNLHLPDSPDDAEFFTSVVTGYWNMFKQNIGIMIAVAQLAATQQRFAEVQNSFRRFGIDIVVASVRRAQEQGHAVGLVPEHIGAAIALLFENFTTVFVGSSGLGVELDDREAITTLATIWKKTLYGF a0r0m8_mycs2 MSMEG_4441 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MLQDWADPESGSTITVIQEVRSPHIPAQVAVITVLVNHPPGARGAPPHRLPGGPAFGYMIAGEMLFERDGEPARVLRAGDAFWGPGGDVIHYQDTNLRTDIPCSFVLTMLRDPALPLLERVDEQELGYREPLRVTKTGDAVTPSVDDVLRDRWHEVTRELVLAQASATLTVDDPQHSHPAGSISITLTGKALGNDLLLADAGRIALDAPQNTAGDGADPPRHPMRVIPMRLDILSELPTIRVSGRGMTESTQLRLVVELAASDPHNATTSVLKCELESVHLDPERPHISMDFHPQNVELHRS a8wa22_9caud 34 Giles_34 protein protein mycobacterium phage giles Mycobacterium phage Giles MAPWGNQPRHRTWASDTVLTSAAAVIVIAIYMCWELFGDEPAPQGMVTLVGLAGGALFGAVSRDKRKREDEVTQTAERAEAKADRLEREVHGDAADADDSAGGRNG a0qri6_mycs2 MSMEG_1130 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MDVLERLDLDTVRDLSQRTDRLGVVSLYFNADPTQNLQVQAIDLRNRYRLLQRRMEADGSQRYRDVAAALERRRPLIETLITGVASGRGRIMFIGLDGDWTVHFECMMPVTNRVVLDDGPFIHPLVEVLDEGRPAGVVVISADDARLLEWRLGQLQEISRIAQPFGQAPQERAGQMREQRQAREREGMQRFLTQVTATATELAEERGWERIVVSGGQRWTEPAKTRFGPPLRGKVLVDRGLGGLDDAALTAAVSARLHRQHKYDEQQLLDYLCDAGGTGDVALGLSEVTAALNAGRVDHLVYDPAVRYVGTVGADGSLYADGEIAPHSHAATKDSRFTERLVDRALATGARISPVEGAADAVLKDAAGVAAVLRW a8wa23_9caud 35 Giles_35 protein protein mycobacterium phage giles Mycobacterium phage Giles MDNAITNLFSWTFVIGVAVGFVASRIYCAARIAWMNRTRPLPGGRARDWRAAFRVDPRHIAGVIGALFLCWSVFQTNANAERYEQAAADTQALAEAVRDCNAQLISAIRGSRGITSENDQLSQNEREQLAKIARLQTDWVAALAAPPADVAKLPFDHPVRQRYNMDVTADYLARVEEIHRAIAAIHDEQNNNVKARPPLPDPNCGT a0r3x1_mycs2 MSMEG_5625 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MSQTTCGPTDTPTDIDIDALREKYRVEREKRLRAEGSKQYVETRDQFAQFGEVDPHTPYVERDSLDIDIDVAVLGGGFAGLLVGASLKKAGVEDVHIIEMGGDFGGVWYWNRYPGIQCDNESYCYIPLLEELGFMPSKKFADGAEIFQHCRNIGKHFGLYDGAIFSTQVRDMRWEDDLKRWRISTNRGDDIRARFVVMASGSFNRPKLPGIPGIKDFGGHIFHSSRWDYSYTGGDTTGNLHKLHDKKVALIGTGATGVQLVPYLGRDAQHLYVFQRTPSTVDERNNTPTDPEWVKTLQPGWQKERQRNFHAWTFEGMALGQPDLVCDFWTELGRNTAARVMALEDPASMTPEQFMAIREEEDYKVMERLRRRVDQLVKDPQTAEALKPYYRFLCKRPCSNDEYLSTFNRPNVTLVDVSETKGVERITQTGIVANGNEYEVDCIIFASGFEITTEIRRRFSIDSIKGRDGVSLYDHWADGYKTLHGMASRGFPNQFFTGFTQVGISANISANYELQGEHIAYVIAEALNRGVTTVEPSQQAQDAWCRTIKENFVDNSAFDAECTPGYYNNEGGGGGEGIRSHLGEPYGPGFYAFGDLLKQWRDKGDLDGLEIS a8wa35_9caud 47 Giles_47 protein protein mycobacterium phage giles Mycobacterium phage Giles MPNSVMDKSPSTGGRPPVRKTAARAAKPEPRTDNPPPPIGAVLTDETHAITAAAKVNGWVLIRTIDLPDGGHRYVYANDLSTNHATRPAMVQLTTDADGRVVHARRDVARRTFTDERTRDTSELHVFDFADSVFRVTP a0qru8_mycs2 MSMEG_1245 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MAEAIRHICGISGGKDSSALAVYMRDRVPEMEYFFCDTGAELPETYEYLDRLETALGKPIARLNARKGFDHWFEVYRGTLPSPQMRWCTKKMKIEPLEEWIGDDYAVSYVAIRADEAGRKGYVSTKPNIRTVLPFVEGGIDHDGVLRILDEAGIGLPKYYEWRTRSGCYFCFYQRKAEWVGLAEKHPELLHRAIAIEAKVRQDAGADGDASFGEYAMKGRQYTWSGGESLPELIARREEILARHAEAQEQAKKRKKNRPVWEVLGDALDDDDDSLQCTVCAL a0qyw6_mycs2 MSMEG_3811 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MSAYQTVVVGTDGSDSSLRAVDRAGQIAAASNAKLIIATAYFPQSEDSRAADVLKDEGYKMAGNAPIYAILREANDRAKAAGATDIEERPVVGAPVDALVELADEVKADLLVVGNVGLSTIAGRLLGSVPANVARRSKTDVLIVHTS a0qrx4_mycs2 MSMEG_1272 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MGSSRIELTAAQRDRAVGVLLGAAAGDALGAGYELNRPLAPDHPVGMIGGGLGPFAPGEWTDDTSMAIAIAEIASTGEDLRKEKPLDYLVERWEWWSRTAPDVGVQTRTVLSETAARGLCAQTARAVSEELHRSSGRTAGNGSLMRTSPVALAYLDDEAALVQAARTISELTHFDPNAGDACVLWCTAIRHTVLTGEIDVRVGLSHIVSERRRLWEARLAEAEASPPSAFCDNNGWVVAALQAAWSAISTTPVPHEDPRSEVFRADHLRLALEAAVRGGGDTDTVAAIAGGLLGAAYGASAVPSQWRRLLHGWPGLRTRGLTALADRTVNKGRPVEFNQSYAAGRETPEPVRHPHDDGVWIGIAYSLNRLPSDIDAVVSLCRVADGHIPLRVVHLDVPLLDQEGANPNLDFVVLDTVRAIEQLRAEGRTVFVHSAAAQNRAPAVAALYGARRQGLGIDRALREVCAVLPSAQPNPDLRAALRRLHVVEAGAR i7fzh1_mycs2 MSMEI_2107 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MSPRWPVPCTTMCAQATGCVYWGFVSADYAIIDMATMYLGAVAVPLQTSAPVGQLQPIVTETEPRLFASSIGDLHTAVDLVLTGHAPARLVVFDHHPAVDEEREALQSARQRLGDAGAQVAIEALADLIERGRSAPEVLYHVDDEDDPLRLLIYTLGQHGRTERRDVPGASGGEFLAQVALELGRHDRPALDHPELHAHESRDGSRHPVRNAGTRWHGVFHRAQRPFDAVRGSRARQAHRAELRSTGVGHALRHLPE a8wa42_9caud 54 Giles_54 protein protein mycobacterium phage giles Mycobacterium phage Giles MIAPKISMDDRTRETVDRFADALLSVAAAVERAAAAVEASNAGARG a0r0l7_mycs2 MSMEG_4430 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MDASEGPAAGHGDTERAVLLATKLHIPAIAGQLVHRTALLDALSQSCRSRLILLSAPVGWGKTTLLSQWALGAGKDQRFGWLSLDASDNDPVWFWMYVIAALQKISPGVGTRAVELLTMGADPIQVVLPTLLNDLDAVARPIVLILDDYHMVVNRAIHEQVAFAVGRMPANLHVVLATRSDPLLPLARLRANGELVEMRSDDLRFGVGEAGQLLNDVLGLDLTEEDVRLLHRRTEGWAAGLYLAALSLAGRAQAAAFIRTFAGDNRHIVDYLMAEVLDRQSPRIRNFLLRTSVMRRFNGALCDAVLQSSDSVSVLEEMERENLFLVPLDMSRHWYRYHHLFGELLRAELHRCEPELVPGLHRRAAKWFEAEGLVDEALRHLVAAGDIAESADLIVEDWANELAGGGLSTVSGWLDLLPEGTVRGDPRLSAIRAWVALNVGLFDDARIWIEAVAAGLEGVSAAEGSARAGLSEQLVALREVYAFKIGDVTNALDAARQAATLEVGEAPPARSAAHVTYGAALYFSGDIDEARTELQRAVELTERTGDRRHRVYALGYLALIEAESGQLADAEHLIRRATGVGPDPAGTQNFIDVAVSLAVSVVLYASGEWAAAADAAHLAVGLARKGAGILEVAKALMVRAKILNDFGDLEAAEKSRSEAGALLRRCPDNVAVHPMIGSAGQGRRVAVAAYNDEHIAEDLTSKELEVLRLLATRLSRRDIGQRLYVSLNTVKTHQRAIYRKLGVDNRNSAVARGRELGLL a0r684_mycs2 MSMEG_6459 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MGMTPSSFGGSGRSSRDNRGLYNPAYEHDACGVAMVADMHGRRSRDIVDKAITALVNLEHRGAQGAEPNTGDGAGILIQVPDAFLRAVVDFDLPEPGSYATGMAFLPQSSRDAAAACESVEKIAEAEGLEVLGWREVPTDDSSLGALARDAMPTFRQLFLGGASGMELERRAYVVRKRAEHELGTKGPGQDGPGRETVYFPSLSGQTFVYKGMLTTPQLKQFYLDLQDERLESALGIVHSRFSTNTFPSWPLAHPFRRIAHNGEINTVTGNENWMRAREALIRTDVFGSDGLDKIVPVCTPGASDTARFDEVLELLHLGGRSLPHAVLMMIPEAWERHEDMDPARRAFYEYHASLMEPWDGPASVCFTDGTVIGAVLDRNGLRPSRIWVTDDGLVVMASEAGVLPLDPAKVVKKMRLQPGRMFLVDTAQGRIVDDEEVKAELAAAEPYQEWLEQGLFHLDELPPGDYVRMPHHRVVLRQQIFGYTYEELNLLVAPMARTGAEALGSMGTDTPIAVLSARPRMLFDYFQQLFAQVTNPPLDAIREEVVTSLQGTVGPEGDLLNPGPESCRQIVLPQPILRNADLSKLICVDPDHEIRGHKHGMRAAVIRCLYPVNRGGVGLKEALDNVRAKVSEAIREGARIIVLSDRESNETMAPIPSLLSVAAVHHHLVRERTRTKVGLVVEAGDAREVHHMATLVGFGAAAINPYMAFESIEDMVDRGVITGLTSDQAKANYVKAAGKGVLKVMSKMGISTLASYTGAQLFQAIGISQQVLDEYFTGLSCPVGGIDLEDIAADVAARHSLAFLDRPDERAHRELEVGGEYQWRREGEYHLFNPDTVFKLQHSTRTGQYSIFKEYTKLVDDQSERIASLRGLLKFREGHRPPVPIEEVEPASEIVKRFSTGAMSYGSISAEAHETLAIAMNRLGGRSNSGEGGEAVHRFNPDENGDWRRSAIKQVASGRFGVTSHYLANCTDIQIKMAQGAKPGEGGQLPGHKVYPWVAEVRHSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPAARIHVKLVSENGVGTVAAGVSKAHADVVLISGHDGGTGASPLTSLKHAGAPWELGLAETQQTLLLNGLRDRIVVQVDGQLKTGRDVVIAALLGAEEFGFATAPLVVSGCIMMRVCHLDTCPVGVATQNPLLRQRFNGKPEFVENFFMFIAEEVRELMAQLGFRTVNEMVGQVGALDTTKAAEHWKAHKLDLTPVLHEPDSAFMNQDLYCSSRQDHGLDKALDQQLIVQSREALDSGTPVRFTAKITNVNRTVGTMLGHEVTKAYGGQGLPDGTIDITFEGSAGNSFGAFVPKGITLRVYGDANDYVGKGLSGGRIVVRPADEAPESFAAEDNIIAGNVVLFGATSGEAFLRGQVGERFAVRNSGAVAVVEGVGDHGCEYMTGGRVVILGPTGRNFAAGMSGGIAYVYDPRAALPKNLNPEMVEIEALEEADTEWLRGILASHVDATDSAVGQRILADWDNELKHFAKVMPRDYKRVLAAIAEAEAKGLTGSDIDDAIMAASNG a0r1f2_mycs2 MSMEG_4731 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MTRSSVIGVLRERASLQPGDVAFTFIDYDTDPEGVAHTLTWSQLNRRVQSLAYEMQARSAVGDRAVILAPQGLDYVVAFLASLQAGRIGVPLSVPFPGVHDDRVTAVLRDTAPSIVLTTSAVSSHIAEYLEPQAGQAAPWIAEIDTLDLDTRRRPVKREQAPETAYLQYTSGSTRTPAGVMVSHRNLTANFEQVVAGFFPDNIAPSDTTSISWLPLYHDMGLMLGLCAPVLGGWHTVLISPFAFLAKPARWMQLLATHPATVTAAPNFAFDLAARKTSDADLTGMDLGDVRCVLSGSERVHEPTLRRFSDRFAAFNLHEQALRPSYGLAEATLFVATRETGHPPKVARFAAQELSDGRAVPCDDENGTALVSYGMPESPTVRIVDPQTRAECPTGIVGEIWVHGENVCAGYWEQSERTETTFGASIDSPSAGTPTGPWLRTGDLGFVSGGELFIVGRIKDVVIIRGRNHYPDDIEATVQEITRARAAAISVDRDDAEHLVVIAEVRENQNPDVSPAEYLADLEGEVVAAVSRSHGIIPADLVLVRRGAIPITTSGKVRRASCAEQYRDDTFARLVHA a8wa44_9caud 56 Giles_56 protein protein mycobacterium phage giles Mycobacterium phage Giles MSDDITIPGDEAYLSFGGWAKSMPNPPALHERRRYIVDVECTAAGVKSSEKGERSTRSLSILRVMPVAGAVVPPKGDDDDDTPPMFNEDGSVADEASADEGDEIMAERREAAERAAADAAQAAAEAEAGDVDVVDDDTTGDEVPEDPDDDPTSGDVDVDDDADGWDADVDADVADADADGGTVTSLFREAGA a0qxz9_mycs2 MSMEG_3483 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MPKVLTVNVAHPRPNPDNGKRVTGIDKRPVDGAVEVRSPGPRRGGLGSGLVGDVIGNSKHHGGDDQAVYAYAREDLDDWQVALDRELTNGMFGENLTTEGIDVTNAVIGERWRIGTGGLELEVTRPRTPCRTFAAFLEINGLMKTFTRAGNPGAYLRLVRPGHVRAGDSVEIVERPDHGITIGFVFRALTGESELLPEILRADALAAELKERAGRRVGTAG a8wa52_9caud 64 Giles_64 protein protein mycobacterium phage giles Mycobacterium phage Giles MTNPYAEPTEADLATAGNALGLLTTLWPMMPKPDGFALEAWALVIAEHRLDWADVRAAIVKMSADERNADPQFRPTPPFVVKYARMIRRDRVERTGDRTAYEAICDAKAAPDDEPAAAVSASGPVAALPTGRGDLRRVAAGMFRSINDDVEAVKRVDAAQRRRRP a0r6w9_mycs2 MSMEG_6699 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MSGNQLAELLAKEASDALEPLFGLLESIREDVLAIRPPRAPLTEAHFSGLQRRLADVLQGRHDVWGMGFIAAPFVVEGKERYLAWWQRRGDDRVARLRLNFDPTSVDVYDYLQMDFYQLAQRGQARVAYGPYVDYSGSDMYTITATVPVVADEVFLGIAGADLVVGEVERNLLAVLRQTARDAVVVNTERRVLAANTPRWFVGSRLPQMPEQSANPRPDEFREVAEMPLGTGWVVAIGLFALDGVETISCFRAVIEGSGWLGVCRRRSGRARGRAECPGAVWTWRCCRS pyrg_mycs2 CTP synthase pyrG Cytidine 5'-triphosphate synthase Cytidine triphosphate synthetase UTP--ammonia ligase MSMEG_3746 MSMEI_3656 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MPALRKHPQTATKHLFVTGGVVSSLGKGLTASSLGQLLTARGLQVTMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAETDLDVGHYERFLDRNLSGSANVTTGQVYSSVIAKERRGEYLGDTVQVIPHITDEIKSRILAMAEPDAAGVRPDVVITEVGGTVGDIESLPFLEAARQVRHEVGRENCFFLHVSLVPYLAPSGELKTKPTQHSVAALRSIGITPDALILRCDRDVPEPLKNKIALMCDVDVDGVISTPDAPSIYDIPKVLHREELDAYVVRRLNLPFRDVDWTEWDDLLRRVHEPQETVRIALVGKYIDLSDAYLSVAEALRAGGFKHRAKVEMRWVASDDCETEHGAAAALSDVHGVLIPGGFGIRGIEGKIGAISYARKRGLPVLGLCLGLQCIVIEAARSVGITEANSAEFDPKTPDPVISTMADQRDAVAGEADLGGTMRLGAYPAVLTPNSVVAQAYQSTEVSERHRHRFEVNNAYRDRIAKSGLRFSGTSPDGHLVEFVEYDPQIHPFLVGTQAHPELKSRPTRPHPLFAAFIGAAIDYKAAERLPGMDLPEQFVPVEHSDADAPALEEPLEKSDVRG a0r3h8_mycs2 MSMEG_5478 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MPASPYTVNCSILLTELPLLQRPEAARAAGFDAVEFWWPFAEATPSDREVDEFVSAISDAGVQLTGLNFAAGDMPGGERGILSHPGRSADFRASVDIAVEIAKRLGTKAFNALYGNRRDDAGVDEQDAAAVENLIYASEATRAIDAVVLIEPVSGSPLYPLKLAADAVAVIDRVAAQSDGTANNLRLLADVYHMSVNGDDVPAALEGHADLIGHVQIADAPGRGEPGTGSLPLAGYLEQLAGYGYRGYVGLEYKASREDPFDWLPLEHRSVHARADR a0qzu6_mycs2 Mutator family transposase MSMEG_4154 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MTQDHSALLAQLDALKSADAGAVFAELIRAGLQALIEAEATEVIGAGRYQRTDGRATHRNGHRPKTVSTTAGDVEVQIPKLRAGSFFPSLLERRRRIDRALHAVIMEAYVHGVSTRSVDDLVAALGVGSGVSKSEVSRICAGLDKEIDAFRTRSLNHTSFPYVFCDATFCKVRIGAHVVSQALVVATGVSIDGTREVLGTAVGDSESFEFWREFLASLKARGLSGVHLVISDAHAGLKAAVAQQFTGSSWQRCRVHFMRNLHGVVAAKHAPAVTAAVKTIFAHTDPVDVAAQWDQVADTLAASFPKVAAMMDEAKADVLAFTAFPRTHWQKIWSNNPIVICSAAVSVFYVDHEGSEWSVLRSGCGYLQPSMKQILEGRCACCEGGFTALVA gatb_mycs2 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B gatB MSMEG_2367 MSMEI_2307 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MTAATTAELVDFDDVVARYEPVMGMEVHVELSTATKMFCGCANRFGAEPNTLVCPVCLGLPGALPVLNEAAVESAIRIGLALNCEITPWGRFARKNYFYPDQPKNYQISQYDEPIAVDGYLDVPLEDGTTWRVEIERAHMEEDTGKLTHLGSDTGRIAGATTSLADYNRAGVPLIEIVTKPIEGAGARAPEIARAYVTALRQLMRALDVSDVRMDQGSMRCDSNVSLKPKGAKEFGTRTETKNVNSLRSVEVAVRYEMRRQAAVLDAGGTVTQETRHFHEDGYTSPGRSKETAQDYRYFPEPDLEPVAPSPELVERLRTTIPELPWLARKRIQDDWGVSDEVMRDLVNAGAVELVAATVDHGVSSEAARAWWGNFLVQKANEAGVELDELPISPAQVAAVVKLVDEGKLSNKLARQVVEGVLAGEGEPEQVMTDRGLALVRDDSVIQAAVDEALAANPDIVEKIRGGKVQAAGAIVGAVMKATKGSADAARVRELVLAACGQS a0qtt2_mycs2 MSMEG_1954 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MSDIKRGSVARNAKLAGLAGGMAGRAALGFGKRLTGKSKDEVTAELMDKAAQQLFTVLGELKGGAMKVGQALSVMEAAIPEQYGKPYREALTKLQKDAPPLPAAKVHRVLDAQLGTKWRDRFSSFDDKPVASASIGQVHKGIWSDGREVAVKIQYPGADEALRADLKTIQRLVGVFKQLAPGADIQGVVDELTERTEMELDYRLEADNQRAFAKAYRNDPHFAVPAIIASAPKVVISEWMEGIPMSVIIREGTPEQRDLMGTRLTELTFGAPARLEMMHGDAHPGNFMLLPDGRMGVIDFGAVAPLPGGFPTSLGETIRLARDKNYDELLPTMERAGFLQKGQEVSIEEVEDMLRQYVDPIKVDVFHYNRKWLQKMAASQMDNSVAQIKMARSLDLPANLAIPLRVIASTVAICCQLDAHVPVKVIATELVPGFAEEAA a8wa53_9caud 65 Giles_65 protein protein mycobacterium phage giles Mycobacterium phage Giles MTDMWDDPVDLDTVADWDTEAPQTGPASPETDERASGEGLDAGGPYDDTEAAYWRTVRDPDTPAYTRADGTAYATWLENERRVAMQVSCPVCKVVVEQPCIRVRGNPPTPVHPPEPIRKYPAHNDRLRAARRKQTPQ a0r6x2_mycs2 MSMEG_6702 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MTATAQLPYRSTNPATGDVLAEFDTTTDDQVFAAIAAADEAFRSWRSTPLDERADVVRTVGKLLRERADDFAKLAQLEMGKKRGQGAGETRFSASIFEFYADRGAGLLADEPIPTFTGGQAVIRRQPVGVLLGVMPWNFPVYQIARFAAPNLVLGNTMLLKHAESVPQCALAFAELMRDAGVPEGVYTNLFATFDQVATIIADPRVQGVSVTGSERAGAAIAGLAGQSLKKCVLELGGSDPFIVLDGDPKELARTAWNFRMHNMGQACNSNKRIIVLDTIYDDFVTELVAAAEAFTGEEIAPLSSRAAAENLAAQVADAVDKGATLHTGGVLAEAPKAYFTPAVLTGVTPGMRAYTEELFGPVAVVYRVADAEEAVALANSTDFGLGASVFSADTARAEAVARRLEAGMVNVNTPSGDGPDIPFGGIKRSGFGRELGTLGIDEFVNKQVYVVAESSSSSD a0r3y7_mycs2 MSMEG_5641 protein protein mycs2 Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) MSGNDILAPADVDDPLRIVLVAPPYFDIPPKGYGGTEAVVADLADTLTARGHHVTVLGAGAPGTAARFQPLWERTLPDRLGQPYPEIMHALKVRKAIERIAATEGVDIVHDHTFAGPLNAPFYRKLGLPTVVTVHGPIDEDLYPYYRELGDDIGLIAISDRQRELAPDLNWVGRVHNALRIDDWPFNTVKKDYALFLGRYAPYKGAHLALEAGHAAGMPLVLAGKCSEPPEIAYFDEQVKPLLTDSDHVFGMADAQAKRKLLAEARCLVFPIQWEEPFGMVMIEAMACGTPVVALRGGAVPEVIVDGVTGVICDVPEELPAAMEKATHLDPAACRRHVAAHFGVGRFGAGYEQIYRNVLRQRTRMTLREVLTEPPGVAERASA 17-a0qt01_mycs2-1 3321796 N/A 3321798 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 0 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 0 17-phou-1 3321796 N/A 3321800 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 50 29-a0qtx7_mycs2-1 3321796 N/A 3321801 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321802 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 66.66 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 66.66 29-rplw-1 3321796 N/A 3321803 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321802 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 0 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 0 31-a0r3s1_mycs2-1 3321796 N/A 3321804 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 66.66 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 66.66 31-a0qu44_mycs2-1 3321796 N/A 3321806 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 20 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 20 34-a0r0m8_mycs2-1 3321796 N/A 3321807 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321808 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 98 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 98 35-a0qri6_mycs2-1 3321796 N/A 3321809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321810 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 66.66 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 66.66 47-a0r3x1_mycs2-1 3321796 N/A 3321811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321812 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 50 47-a0qru8_mycs2-1 3321796 N/A 3321813 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321812 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 50 47-a0qyw6_mycs2-1 3321796 N/A 3321814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321812 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 50 47-a0qrx4_mycs2-1 3321796 N/A 3321815 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321812 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 50 54-i7fzh1_mycs2-1 3321796 N/A 3321816 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321817 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 90 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 90 54-a0r0l7_mycs2-1 3321796 N/A 3321818 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321817 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 90 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 90 54-a0r684_mycs2-1 3321796 N/A 3321819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321817 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 20 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 20 56-a0r1f2_mycs2-1 3321796 N/A 3321820 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321821 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 98 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 98 64-a0qxz9_mycs2-1 3321796 N/A 3321822 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321823 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 66.66 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 66.66 64-a0r6w9_mycs2-1 3321796 N/A 3321824 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321823 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 66.66 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 66.66 64-pyrg-1 3321796 N/A 3321825 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321823 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 66.66 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 66.66 64-a0r3h8_mycs2-1 3321796 N/A 3321826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321823 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 50 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 50 64-a0qzu6_mycs2-1 3321796 N/A 3321827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321823 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 0 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 0 64-gatb-1 3321796 N/A 3321828 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321823 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 0 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 0 65-a0qtt2_mycs2-1 3321796 N/A 3321829 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321830 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 66.66 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 66.66 65-a0r6x2_mycs2-1 3321796 N/A 3321831 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321830 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 66.66 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 66.66 65-a0r3y7_mycs2-1 3321796 N/A 3321832 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321830 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 0 Table S1, Fig.1A the score was calculated as in ref PMID25986902: A score, 3-ATS, was calculated for each interacting bait-prey pair using the formula 3-ATS = (CPPI _ CB/CPPI) _ 100, where 3-ATS is the 3-AT score calculated for each PPI, CPPI is the highest concentration of 3-AT at which a PPI was scored, and CB is the concentration of 3-AT at which background was observed. 0 17-a0qt01_mycs2-2 3321797 N/A 3321798 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 17-phou-2 3321797 N/A 3321800 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321799 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 29-a0qtx7_mycs2-2 3321797 N/A 3321801 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321802 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 29-rplw-2 3321797 N/A 3321803 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321802 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 31-a0r3s1_mycs2-2 3321797 N/A 3321804 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 31-a0qu44_mycs2-2 3321797 N/A 3321806 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321805 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 34-a0r0m8_mycs2-2 3321797 N/A 3321807 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321808 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 35-a0qri6_mycs2-2 3321797 N/A 3321809 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321810 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 47-a0r3x1_mycs2-2 3321797 N/A 3321811 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321812 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 47-a0qru8_mycs2-2 3321797 N/A 3321813 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321812 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 47-a0qyw6_mycs2-2 3321797 N/A 3321814 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321812 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 47-a0qrx4_mycs2-2 3321797 N/A 3321815 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321812 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 54-i7fzh1_mycs2-2 3321797 N/A 3321816 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321817 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 54-a0r0l7_mycs2-2 3321797 N/A 3321818 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321817 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 54-a0r684_mycs2-2 3321797 N/A 3321819 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321817 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 56-a0r1f2_mycs2-2 3321797 N/A 3321820 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321821 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 64-a0qxz9_mycs2-2 3321797 N/A 3321822 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321823 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 64-a0r6w9_mycs2-2 3321797 N/A 3321824 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321823 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 64-pyrg-2 3321797 N/A 3321825 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321823 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 64-a0r3h8_mycs2-2 3321797 N/A 3321826 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321823 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 64-a0qzu6_mycs2-2 3321797 N/A 3321827 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321823 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 64-gatb-2 3321797 N/A 3321828 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321823 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 65-a0qtt2_mycs2-2 3321797 N/A 3321829 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321830 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 65-a0r6x2_mycs2-2 3321797 N/A 3321831 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321830 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B 65-a0r3y7_mycs2-2 3321797 N/A 3321832 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 3321830 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false Table1, Table S1, Fig.1B