IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kuroki-2017-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Kuroki K., Mio K., Takahashi A., Matsubara H., Kasai Y., Manaka S., Kikkawa M., Hamada D., Sato C., Maenaka K. The Introduction states:- "(isoforms)....HLA-G2 and HLA-G6 (hereafter referred to as HLA-G2 because they have essentially identical ectodomains)" The N terminal amino acid of HLA-G2 constructs has been determined to be residue 25 (UniProt P17693), as translated from the 5' primer given in Methods section. The C terminal residues is 299, as determined by Blat . The sequence of the rsHLA-G2 construct from Ref. 9 has been assumed to be similar. maenaka@pharm.hokudai.ac.jp Journal of immunology (Baltimore, Md. : 1950) 2017 imex curation Only protein-protein interactions imex curation kuroki-2017-1 ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Kuroki K., Mio K., Takahashi A., Matsubara H., Kasai Y., Manaka S., Kikkawa M., Hamada D., Sato C., Maenaka K. The Introduction states:- "(isoforms)....HLA-G2 and HLA-G6 (hereafter referred to as HLA-G2 because they have essentially identical ectodomains)" The N terminal amino acid of HLA-G2 constructs has been determined to be residue 25 (UniProt P17693), as translated from the 5' primer given in Methods section. The C terminal residues is 299, as determined by Blat . The sequence of the rsHLA-G2 construct from Ref. 9 has been assumed to be similar. maenaka@pharm.hokudai.ac.jp Journal of immunology (Baltimore, Md. : 1950) 2017 imex curation Only protein-protein interactions imex curation kuroki-2017-2 in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Kuroki K., Mio K., Takahashi A., Matsubara H., Kasai Y., Manaka S., Kikkawa M., Hamada D., Sato C., Maenaka K. The Introduction states:- "(isoforms)....HLA-G2 and HLA-G6 (hereafter referred to as HLA-G2 because they have essentially identical ectodomains)" The N terminal amino acid of HLA-G2 constructs has been determined to be residue 25 (UniProt P17693), as translated from the 5' primer given in Methods section. The C terminal residues is 299, as determined by Blat . The sequence of the rsHLA-G2 construct from Ref. 9 has been assumed to be similar. maenaka@pharm.hokudai.ac.jp Journal of immunology (Baltimore, Md. : 1950) 2017 imex curation Only protein-protein interactions imex curation lirb2_human Leukocyte immunoglobulin-like receptor subfamily B member 2 LILRB2 ILT4 LIR2 MIR10 CD85 antigen-like family member D Immunoglobulin-like transcript 4 Monocyte/macrophage immunoglobulin-like receptor 10 protein protein human Homo sapiens Human MTPIVTVLICLGLSLGPRTHVQTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVVLLLLLLLLLFLILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKDTQPEDGVEMDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLAIH p17693-2 HLA class I histocompatibility antigen, alpha chain G HLA G antigen MHC class I antigen G HLA-G2 HLA-G HLA-6.0 HLAG protein protein human Homo sapiens Human MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEAKPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD lilrb2-hla_g-1 2973140 N/A 2973143 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed first_two_ecds sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 2973144 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecd_alpha1+3_regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P17693-2:p.Cys66Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 physical association physical association false false false 2973140 Figure 3A-RHS, 3C, Supp fig 2B, table 1 lilrb2-hla_g-2 2973140 N/A 2973143 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed first_two_ecds sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 2973144 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecd_alpha1+3_regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P17693-2:p.Lys207Asn mutation mutation certain certain sequence position certain certain certain sequence position certain false human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association false false false Figuere 3A-LHS lilrb2-hla_g-3 2973140 N/A 2973143 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed first_two_ecds sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 2973144 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecd_alpha1+3_regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P17693-2:p.Cys66Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 2973167 2973163 physical association physical association false false false 2973140 Figure 3B hla_g-8 2973141 N/A 2973144 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecd_alpha1+3_regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P17693-2:p.Cys66Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 physical association physical association false false false 1C Unexpectedly, however, refolded HLA-G2 and HLA-G2(C42S) proteins eluted at an elution volume indicative of a dimer species. hla_g-1 2973142 N/A 2973144 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecd_alpha1+3_regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P17693-2:p.Cys66Ser mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 physical association physical association false false false Figure 2