IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kim-2017-3 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kim H., Chun Y., Che L., Kim J., Lee S., Lee S. leesoojin@cnu.ac.kr Biochemical and biophysical research communications 2017 imex curation Only protein-protein interactions kim-2017-1 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kim H., Chun Y., Che L., Kim J., Lee S., Lee S. leesoojin@cnu.ac.kr Human testis library Biochemical and biophysical research communications 2017 imex curation Only protein-protein interactions kim-2017-2 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kim H., Chun Y., Che L., Kim J., Lee S., Lee S. leesoojin@cnu.ac.kr Biochemical and biophysical research communications 2017 imex curation Only protein-protein interactions kim-2017-4 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kim H., Chun Y., Che L., Kim J., Lee S., Lee S. leesoojin@cnu.ac.kr human testis library Biochemical and biophysical research communications 2017 imex curation Only protein-protein interactions kim-2017-5 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kim H., Chun Y., Che L., Kim J., Lee S., Lee S. leesoojin@cnu.ac.kr Biochemical and biophysical research communications 2017 imex curation Only protein-protein interactions kim-2017-6 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Kim H., Chun Y., Che L., Kim J., Lee S., Lee S. leesoojin@cnu.ac.kr Biochemical and biophysical research communications 2017 imex curation Only protein-protein interactions kim-2017-7 human-crt-mg human GBM/Astrocytoma cell line Human crt-mg CRT_MG GBM/Astrocytoma cell line I could not find any definitive ref for this cell line nor in any cell line database I can find; it is pre-2000 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Kim H., Chun Y., Che L., Kim J., Lee S., Lee S. leesoojin@cnu.ac.kr Biochemical and biophysical research communications 2017 imex curation Only protein-protein interactions kim-2017-8 human-u178 human-Astrocytoma cell line Human u178 U178 Astrocytoma cell line http://web.expasy.org/cellosaurus/CVCL_A758 fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Kim H., Chun Y., Che L., Kim J., Lee S., Lee S. leesoojin@cnu.ac.kr Biochemical and biophysical research communications 2017 imex curation Only protein-protein interactions negr1_human Neuronal growth regulator 1 NEGR1 IGLON4 IgLON family member 4 UNQ2433/PRO4993 protein protein human Homo sapiens Human MDMMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRCYLEDGASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKNAILQ npc2_human NPC intracellular cholesterol transporter 2 NPC2 Niemann-Pick disease type C2 protein HE1 Human epididymis-specific protein 1 Epididymal secretory protein E1 protein protein human Homo sapiens Human MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQIVSHL w76ys4rrzyy-1 2876275 N/A 2876283 unspecified role unspecified role prey prey asp39 gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag certain certain sequence position certain certain certain sequence position certain false N/A 2876284 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B npc2-negr1-1 2876275 N/A 2876283 unspecified role unspecified role bait bait pro314 flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged certain certain sequence position certain certain certain sequence position certain false N/A 2876284 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B-2 negr1-npc2-5 2876276 N/A 2876284 unspecified role unspecified role prey prey N/A 2876283 unspecified role unspecified role bait bait Ig-like C2-type 1+2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false no figure negr1-npc2-1 2876277 N/A 2876284 unspecified role unspecified role prey prey N/A 2876283 unspecified role unspecified role bait bait Ig-like C2-type 1+2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Ig-like C2-type 2 + 3 sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain false physical association physical association false false false 1A negr1-npc2-2 2876278 N/A 2876284 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) N/A 2876283 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 1D negr1-npc2-3 2876279 N/A 2876284 unspecified role unspecified role prey prey N/A 2876283 unspecified role unspecified role bait bait physical association physical association false false false 1E npc2-negr1-2 2876280 N/A 2876284 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 2876283 unspecified role unspecified role bait bait Ig-like C2-type 2+3 sufficient to bind sufficient binding region sufficient to bind range range range range false n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false 1F agaegr-1 2876281 N/A 2876284 unspecified role unspecified role neutral component neutral component N/A 2876283 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2A negr1-npc2-4 2876282 N/A 2876284 unspecified role unspecified role neutral component neutral component N/A 2876283 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 2A