UniProt UniProt http://www.uniprot.org guo-2017-1 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Guo DC., Duan XY., Regalado ES., Mellor-Crummey L., Kwartler CS., Kim D., Lieberman K., de Vries BB., Pfundt R., Schinzel A., Kotzot D., Shen X., Yang ML., null null., Bamshad MJ., Nickerson DA., Gornik HL., Ganesh SK., Braverman AC., Grange DK., Milewicz DM. Origin of transfected INO80E according Ref. 12 (PMID 17721549, and ADDGENE) dianna.m.milewicz@uth.tmc.edu American journal of human genetics 2017 imex curation Only protein-protein interactions guo-2017-2 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunostaining immunostaining Guo DC., Duan XY., Regalado ES., Mellor-Crummey L., Kwartler CS., Kim D., Lieberman K., de Vries BB., Pfundt R., Schinzel A., Kotzot D., Shen X., Yang ML., null null., Bamshad MJ., Nickerson DA., Gornik HL., Ganesh SK., Braverman AC., Grange DK., Milewicz DM. dianna.m.milewicz@uth.tmc.edu American journal of human genetics 2017 imex curation Only protein-protein interactions guo-2017-3 human-vsmc Homo sapiens aortic vascular smooth muscle cells vsmc Human aortic vascular smooth muscle cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Guo DC., Duan XY., Regalado ES., Mellor-Crummey L., Kwartler CS., Kim D., Lieberman K., de Vries BB., Pfundt R., Schinzel A., Kotzot D., Shen X., Yang ML., null null., Bamshad MJ., Nickerson DA., Gornik HL., Ganesh SK., Braverman AC., Grange DK., Milewicz DM. dianna.m.milewicz@uth.tmc.edu American journal of human genetics 2017 imex curation Only protein-protein interactions guo-2017-4 human-vsmc Homo sapiens aortic vascular smooth muscle cells vsmc Human aortic vascular smooth muscle cells confocal microscopy confocal microscopy immunostaining immunostaining Guo DC., Duan XY., Regalado ES., Mellor-Crummey L., Kwartler CS., Kim D., Lieberman K., de Vries BB., Pfundt R., Schinzel A., Kotzot D., Shen X., Yang ML., null null., Bamshad MJ., Nickerson DA., Gornik HL., Ganesh SK., Braverman AC., Grange DK., Milewicz DM. dianna.m.milewicz@uth.tmc.edu American journal of human genetics 2017 imex curation Only protein-protein interactions tyy1_human Transcriptional repressor protein YY1 Yin and yang 1 Delta transcription factor NF-E1 YY1 INO80S INO80 complex subunit S protein protein human Homo sapiens Human MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHGGGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKSGKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ ruvb1_human RuvB-like 1 RUVBL1 NMP238 TIP49 TIP49A 49 kDa TATA box-binding protein-interacting protein TIP49a Pontin 52 Nuclear matrix protein 238 54 kDa erythrocyte cytosolic protein INO80H TIP60-associated protein 54-alpha INO80 complex subunit H protein protein human Homo sapiens Human MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK yyap1_human YY1-associated protein 1 YY1AP1 HCCA2 YY1AP Hepatocellular carcinoma susceptibility protein Hepatocellular carcinoma-associated protein 2 protein protein human Homo sapiens Human MEEEASRSAAATNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMEDLFETFQDEMGFSNMEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASSTRICLKELGTFAQSSIALHHQYNPKFQTLFQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILATSKVFMYPELLPVCSLKAKNPQDKILFTKAEDNKYLLTCKTARQLTVRIKNLNMNRAPDNIIKFYKKTKQLPVLGKCCEEIQPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEINSDQGLEKDNSELGSETRYPLLLPKGVVLKLKPVADRFPKKAWRQKRSSVLKPLLIQPSPSLQPSFNPGKTPAQSTHSEAPPSKMVLRIPHPIQPATVLQTVPGVPPLGVSGGESFESPAALPAMPPEARTSFPLSESQTLLSSAPVPKVMMPSPASSMFRKPYVRRRPSKRRGARAFRCIKPAPVIHPASVIFTVPATTVKIVSLGGGCNMIQPVNAAVAQSPQTIPIATLLVNPTSFPCPLNQPLVASSVSPLIVSGNSVNLPIPSTPEDKAHMNVDIACAVADGENAFQGLEPKLEPQELSPLSATVFPKVEHSPGPPPVDKQCQEGLSENSAYRWTVVKTEEGRQALEPLPQGIQESLNNSSPGDLEEVVKMEPEDATEEISGFL in80e_human INO80 complex subunit E CCDC95 Coiled-coil domain-containing protein 95 INO80E protein protein human Homo sapiens Human MNGPADGEVDYKKKYRNLKRKLKFLIYEHECFQEELRKAQRKLLKVSRDKSFLLDRLLQYENVDEDSSDSDATASSDNSETEGTPKLSDTPAPKRKRSPPLGGAPSPSSLSLPPSTGFPLQASGVPSPYLSSLASSRYPPFPSDYLALQLPEPSPLRPKREKRPRLPRKLKMAVGPPDCPVGGPLTFPGRGSGAGVGTTLTPLPPPKMPPPTILSTVPRQMFSDAGSGDDALDGDDDLVIDIPE in80c_human INO80 complex subunit C INO80C C18orf37 IES6 homolog protein protein human Homo sapiens Human MAAQIPIVATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISMEAMSENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKNLKQILASERALPWQLNDPNYFSIDAPPSFKPAKKYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTGYLALRKATSIVP ino80e-ruvbl1-1 2970867 N/A 2970871 unspecified role unspecified role prey prey N/A 2970872 unspecified role unspecified role prey prey N/A 2970873 unspecified role unspecified role prey prey N/A 2970874 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false association association false false false 3A yy1-yy1ap1-1 2970868 N/A 2970871 unspecified role unspecified role neutral component neutral component N/A 2970873 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3B yy1ap1-ino80c-1 2970869 N/A 2970873 unspecified role unspecified role bait bait N/A 2970875 unspecified role unspecified role prey prey N/A 2970871 unspecified role unspecified role prey prey association association false false false 3C yy1-yy1ap1-8 2970870 N/A 2970871 unspecified role unspecified role neutral component neutral component N/A 2970873 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 3D