IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ silva-2017-1 human-sperm Homo sapiens - sperm sperm anti bait coip anti bait coimmunoprecipitation anti bait coip sequence tag sequence tag identification sequence tag Silva JV., Yoon S., De Bock PJ., Goltsev AV., Gevaert K., Mendes JF., Fardilha M., Silva JV., Yoon S., De Bock PJ., Goltsev AV., Gevaert K., Mendes JF., Fardilha M. mfardilha@ua.pt Biochimica et biophysica acta 2017 Only protein-protein interactions imex curation imex curation silva-2017-2 human-sperm Homo sapiens - sperm sperm anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Silva JV., Yoon S., De Bock PJ., Goltsev AV., Gevaert K., Mendes JF., Fardilha M., Silva JV., Yoon S., De Bock PJ., Goltsev AV., Gevaert K., Mendes JF., Fardilha M. Sperm soluble extract mfardilha@ua.pt Biochimica et biophysica acta 2017 Only protein-protein interactions imex curation imex curation silva-2017-3 in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Silva JV., Yoon S., De Bock PJ., Goltsev AV., Gevaert K., Mendes JF., Fardilha M., Silva JV., Yoon S., De Bock PJ., Goltsev AV., Gevaert K., Mendes JF., Fardilha M. Human sperm soluble extract was immunoprecipitated with anti-AKAP4 antibody and extracts were run on SDS-PAGE gels. mfardilha@ua.pt Biochimica et biophysica acta 2017 Only protein-protein interactions imex curation imex curation silva-2017-4 human-sperm Homo sapiens - sperm sperm fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Silva JV., Yoon S., De Bock PJ., Goltsev AV., Gevaert K., Mendes JF., Fardilha M., Silva JV., Yoon S., De Bock PJ., Goltsev AV., Gevaert K., Mendes JF., Fardilha M. Human sperm soluble extract was immunoprecipitated with anti-AKAP4 antibody and extracts were run on SDS-PAGE gels. mfardilha@ua.pt Biochimica et biophysica acta 2017 Only protein-protein interactions imex curation imex curation akap4_human A-kinase anchor protein 4 AKAP4 AKAP82 A-kinase anchor protein 82 kDa Major sperm fibrous sheath protein Protein kinase A-anchoring protein 4 protein protein human Homo sapiens Human MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEEKEIIVIKDTEKKDQSKTEGSVCLFKQAPSDPVSVLNWLLSDLQKYALGFQHALSPSTSTCKHKVGDTEGEYHRASSENCYSVYADQVNIDYLMNRPQNLRLEMTAAKNTNNNQSPSAPPAKPPSTQRAVISPDGECSIDDLSFYVNRLSSLVIQMAHKEIKEKLEGKSKCLHHSICPSPGNKERISPRTPASKIASEMAYEAVELTAAEMRGTGEESREGGQKSFLYSELSNKSKSGDKQMSQRESKEFADSISKGLMVYANQVASDMMVSLMKTLKVHSSGKPIPASVVLKRVLLRHTKEIVSDLIDSCMKNLHNITGVLMTDSDFVSAVKRNLFNQWKQNATDIMEAMLKRLVSALIGEEKETKSQSLSYASLKAGSHDPKCRNQSLEFSTMKAEMKERDKGKMKSDPCKSLTSAEKVGEHILKEGLTIWNQKQGNSCKVATKACSNKDEKGEKINASTDSLAKDLIVSALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQANGQFIDKLVESVMKLCLIMAKYSNDGAALAELEEQAASANKPNFRGTRCIHSGAMPQNYQDSLGHEVIVNNQCSTNSLQKQLQAVLQWIAASQFNVPMLYFMGDKDGQLEKLPQVSAKAAEKGYSVGGLLQEVMKFAKERQPDEAVGKVARKQLLDWLLANL p36873-2 Serine/threonine-protein phosphatase PP1-gamma catalytic subunit Protein phosphatase 1C catalytic subunit PPP1CC Gamma-2 PPPCC2 protein protein human Homo sapiens Human MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRVASGLNPSIQKASNYRNNTVLYE 1433t_human 14-3-3 protein theta YWHAQ 14-3-3 protein tau 14-3-3 protein T-cell Protein HS1 protein protein human Homo sapiens Human MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN aq345ezy-1 3317461 N/A 3317465 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317466 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317467 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level association association false false false Figure 4A, table 2 Several previously well-characterized PPP1 interacting proteins were also identified; however these are not stated. ppp1cc-akap4-1 3317462 N/A 3317465 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level N/A 3317466 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false Figure 4B ppp1cc-akap4-2 3317463 N/A 3317465 unspecified role unspecified role prey prey partially purified partially purified human-sperm Homo sapiens - sperm sperm N/A 3317466 unspecified role unspecified role bait bait purified purified physical association physical association false false false Figure 4C ppp1cc-akap4-3 3317464 N/A 3317465 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell N/A 3317466 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization false false false Figure 4D