IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ levy-2016-3 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. The SMEZ protein has been entered from the Reference Proteome as no strain is stated. kaempfer@hebrew.edu Proceedings of the National Academy of Sciences of the United States of America 2016 Only protein-protein interactions imex curation imex curation levy-2016-1 in vitro In vitro confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. Figure 2A:It is stated:- "B7-2 having GFP fused C-terminally to its intracellular domain". However primer sequences do not unambiguously confirm that the intracellular domain was used. kaempfer@hebrew.edu Proceedings of the National Academy of Sciences of the United States of America 2016 Only protein-protein interactions imex curation imex curation levy-2016-2 in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. kaempfer@hebrew.edu Proceedings of the National Academy of Sciences of the United States of America 2016 Only protein-protein interactions imex curation imex curation levy-2016-4 in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. kaempfer@hebrew.edu Proceedings of the National Academy of Sciences of the United States of America 2016 Only protein-protein interactions imex curation imex curation levy-2016-5 in vitro In vitro facs fluorescence-activated cell sorting FACS Flow cytometry facs tag fluorescence tag visualisation by fluorescence tag fluorescence Levy R., Rotfogel Z., Hillman D., Popugailo A., Arad G., Supper E., Osman F., Kaempfer R. Primers from Ref 12 (and PMID: 2825196 for Cd28 cDNA) show that CD28-GFP is isoform 1 and full length. kaempfer@hebrew.edu Proceedings of the National Academy of Sciences of the United States of America 2016 Only protein-protein interactions imex curation imex curation etxb_staau Enterotoxin type B entB SEB protein protein staau Staphylococcus aureus MYKRLFISHVILIFALILVISTPNVLAESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK p42081-3 T-lymphocyte activation antigen CD86 CD86 CD28LG2 Activation B7-2 antigen B70 BU63 CTLA-4 counter-receptor B7.2 FUN-1 protein protein human Homo sapiens Human MGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREKIHIPERSDEAQRVFKSSKTSSCDKSDTCF 12c 12C peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) CYNKKKATVQELDC SEB derivative:P01552 p06886-pro_0000035619 Toxic shock syndrome toxin-1 tst protein protein staau Staphylococcus aureus STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN 41 234 q99xw1_strp1 smeZ SPy_1998 protein protein strp1 Streptococcus pyogenes serotype M1 MKKTKLIFSFTSIFIAIISRPVFGLEVDNNSLLRNIYSTIVYEYSDTVIDFKTSHNLVTKKLDVRDARDFFINSEMDEYAANDFKDGDKIAMFSVPFDWNYLSEGKVIAYTYGGMTPYQEEPMSKNIPVNLWINRKQIPVPYNQISTNKTTVTAQEIDLKVRKFLISQHQLYSSGSSYKSGKLVFHTNDNSDKYSLDLFYVGYRDKESIFKVYKDNKSFNIDKIGHLDIEIDS p42081-1 T-lymphocyte activation antigen CD86 CD86 CD28LG2 Activation B7-2 antigen B70 BU63 CTLA-4 counter-receptor B7.2 FUN-1 protein protein human Homo sapiens Human MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREKIHIPERSDEAQRVFKSSKTSSCDKSDTCF p10747-1 T-cell-specific surface glycoprotein CD28 CD28 TP44 protein protein human Homo sapiens Human MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS cd86-entb-3 3021807 N/A 3021812 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3021813 unspecified role unspecified role prey prey purified purified c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc direct interaction direct interaction false false false 3021807 2C entb-cd86-2 3021807 N/A 3021813 unspecified role unspecified role prey prey purified purified c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3021814 unspecified role unspecified role bait bait purified purified 12c:p.[Tyr2Ala;Lys4Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false 12c:p.[Lys4Ala;Asp13Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction false false false 3 A/C entb-cd86-3 3021807 N/A 3021812 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 N/A 3021813 unspecified role unspecified role bait bait purified purified pB2-4 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 direct interaction direct interaction false false false 3021807 5A, Table S1 cd86-entb-4 3021807 N/A 3021812 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 N/A 3021813 unspecified role unspecified role bait bait purified purified pB2-6 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 direct interaction direct interaction false false false 3021807 5B, Table S1 cd86-entb-5 3021807 N/A 3021815 unspecified role unspecified role prey prey purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3021813 unspecified role unspecified role bait bait purified purified pB2-4 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 direct interaction direct interaction false false false 3021807 Supp fig 4 A, Table S1 cd86-entb-6 3021807 N/A 3021815 unspecified role unspecified role prey prey purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3021813 unspecified role unspecified role bait bait purified purified pB2-6 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 direct interaction direct interaction false false false 3021807 Supp fig 4B, Table S1 cd86-tst-1 3021807 N/A 3021816 unspecified role unspecified role prey prey purified purified mature_protein sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3021813 unspecified role unspecified role bait bait purified purified pB2-4 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 direct interaction direct interaction false false false 3021807 Supp fig 4 C, Table S1 cd86-tst-2 3021807 N/A 3021816 unspecified role unspecified role prey prey purified purified n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false mature_protein sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 1.0 N/A 3021813 unspecified role unspecified role bait bait purified purified pB2-6 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) Stoichiometry: 1.0 direct interaction direct interaction false false false 3021807 Supp fig 4D, Table S1 cd86-entb-1 3021808 N/A 3021812 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3021817 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false region (intracellular_domain) sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. colocalization colocalization false false false 2A Colocalization of SEB with cell-surface B7-2 cd86-entb-2 3021809 N/A 3021812 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3021813 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc direct interaction direct interaction false false false 2B entb-cd86-1 3021810 N/A 3021812 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P01552:p.[Thr177Ala;Lys179Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) N/A 3021813 unspecified role unspecified role neutral component neutral component purified purified c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc direct interaction direct interaction false false false 3021810 2D cd28-cd86-2 3021811 N/A 3021817 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell c_terminus mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range false Ig_like_domain required to bind necessary binding region required to bind range range range range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. N/A 3021818 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association false false false 7F-J, Supp fig 6 SEB; however the SEB tk2 mutant did not have any agonistic effect. The B7-2C splice variant did not bind CD28. From Ref 18 Figure 1A, this variant is missing the first "Ig like domain", so this variant might correspond to P42081-5.