IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ garcia_beltran-2016-1 in vitro In vitro affinity techniques affinity technology affinity techniques antibody detection identification by antibody antibody detection Garcia-Beltran WF., Hölzemer A., Martrus G., Chung AW., Pacheco Y., Simoneau CR., Rucevic M., Lamothe-Molina PA., Pertel T., Kim TE., Dugan H., Alter G., Dechanet-Merville J., Jost S., Carrington M., Altfeld M. Results from Fig 1A cannot be included as no exact identifiers are provided for HLA-A/B/C proteins. Two non-classical MHC antigens-biotinylated monomers of HLA E/F/G -B2M complex were loaded onto streptavidin-coated beads, and acid pulsed. Binding of KIR3DS1-Fc was detected by anti-Fc antibody addition, bead paraldehyde fixing and fluorescence detection by Flow Cytometry. The HLA-F supplied by Fred Hutchinson Cancer Research Center contains only the extracellular domain. The protein was expressed in E. coli. marcus.altfeld@hpi.uni-hamburg.de Nature immunology 2016 Only protein-protein interactions imex curation imex curation garcia_beltran-2016-2 in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Garcia-Beltran WF., Hölzemer A., Martrus G., Chung AW., Pacheco Y., Simoneau CR., Rucevic M., Lamothe-Molina PA., Pertel T., Kim TE., Dugan H., Alter G., Dechanet-Merville J., Jost S., Carrington M., Altfeld M. The HLA-F supplied by Fred Hutchinson Cancer Research Center contains only the extracellular domain. The protein was expressed in E. coli. marcus.altfeld@hpi.uni-hamburg.de Nature immunology 2016 Only protein-protein interactions imex curation imex curation ki3l1_human Killer cell immunoglobulin-like receptor 3DL1 KIR3DL1 CD158E NKAT3 NKB1 CD158 antigen-like family member E HLA-BW4-specific inhibitory NK cell receptor MHC class I NK cell receptor Natural killer-associated transcript 3 p70 natural killer cell receptor clones CL-2/CL-11 protein protein human Homo sapiens Human MSLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLLHLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKTPPTDTILYTELPNAKPRSKVVSCP hlaf_human HLA class I histocompatibility antigen, alpha chain F HLA-F HLA-5.4 HLAF CDA12 HLA F antigen Leukocyte antigen F MHC class I antigen F protein protein human Homo sapiens Human MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV ki3s1_human Killer cell immunoglobulin-like receptor 3DS1 NKAT10 KIR3DS1 MHC class I NK cell receptor Natural killer-associated transcript 10 protein protein human Homo sapiens Human MLLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHREWISKDPSRLVGQIHDGVSKANFSIGSMMRALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGLYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNLRHLHILIGTSVVKIPFTILLFFLLHRWCSNKKKCCCNGPRACREQK ki3l2_human Killer cell immunoglobulin-like receptor 3DL2 KIR3DL2 CD158 antigen-like family member K CD158K MHC class I NK cell receptor NKAT4 Natural killer-associated transcript 4 p70 natural killer cell receptor clone CL-5 protein protein human Homo sapiens Human MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFMLYKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGNHRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANFSIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENVTLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRALPCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKTPLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF hla_f-kir3dl1-1 3134372 N/A 3134374 unspecified role unspecified role prey prey ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3134375 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1B-1 hla_f-kir3dl1-2 3134372 N/A 3134376 unspecified role unspecified role prey prey ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 3134375 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1 B/C hla_f-kir3ds1-3 3134372 N/A 3134377 unspecified role unspecified role prey prey ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3134375 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecd sufficient to bind sufficient binding region sufficient to bind range range range range false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 1 B hla_f-kir3dl1-3 3134373 N/A 3134374 unspecified role unspecified role prey prey ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3134375 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind range range range range false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3134373 2A, Table 1 hla_f-kir3ds1-4 3134373 N/A 3134376 unspecified role unspecified role prey prey ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. N/A 3134375 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind range range range range false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 3134373 2A, Table 1 hla_f-kir3dl2-4 3134373 N/A 3134377 unspecified role unspecified role prey prey ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c_terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false mouse-nso NSO-mouse myeloma subclone of NS-1 ns0 NS0 Mouse Myeloma subclone of NS-1 http://www.hpacultures.org.uk/products/celllines/generalcell/detail.jsp?refId=85110503&collection=ecacc_gc from ecacc N/A 3134375 unspecified role unspecified role bait bait ecd sufficient to bind sufficient binding region sufficient to bind range range range range false region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 3134373 2A, Table 1