DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ gao-2016-1 in vitro In vitro 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Gao Y., Cao E., Julius D., Cheng Y. DIP original experiment: DIP-269090X Nature 2016 IMEx TRPV1 structures in nanodiscs reveal mechanisms of ligand and lipid action. Gao Y., Cao E., Julius D., Cheng Y. Only protein-protein interactions imex curation gao-2016-2 human Homo sapiens Human molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Gao Y., Cao E., Julius D., Cheng Y. DIP original experiment: DIP-269093X Nature 2016 IMEx TRPV1 structures in nanodiscs reveal mechanisms of ligand and lipid action. Gao Y., Cao E., Julius D., Cheng Y. Only protein-protein interactions imex curation gao-2016-3 human Homo sapiens Human 3d-em 3D electron microscopy 3D-EM electron tomog predetermined predetermined participant predetermined Gao Y., Cao E., Julius D., Cheng Y. DIP original experiment: DIP-269091X Nature 2016 IMEx TRPV1 structures in nanodiscs reveal mechanisms of ligand and lipid action. Gao Y., Cao E., Julius D., Cheng Y. Only protein-protein interactions imex curation gao-2016-4 human Homo sapiens Human tem transmission electron microscopy tem predetermined predetermined participant predetermined Gao Y., Cao E., Julius D., Cheng Y. DIP original experiment: DIP-269092X Nature 2016 IMEx TRPV1 structures in nanodiscs reveal mechanisms of ligand and lipid action. Gao Y., Cao E., Julius D., Cheng Y. Only protein-protein interactions imex curation dktx_cyrsc Tau-theraphotoxin-Hs1a Double-knot toxin protein protein hapsc Haplopelma schmidti Chinese bird spider Ornithoctonus huwenum DCAKEGEVCSWGKKCCDLDNFYCPMEFIPHCKKYKPYVPVTTNCAKEGEVCGWGSKCCHGLDCPLAFIPYCEKYRGRND trpv1_rat Transient receptor potential cation channel subfamily V member 1 Trpv1 Vr1 Vr1l Osm-9-like TRP channel 1 Vanilloid receptor 1 Vanilloid receptor type 1-like Capsaicin receptor protein protein rat Rattus norvegicus (Rat) Rat MEQRASLDSEESESPPQENSCLDPPDRDPNCKPPPVKPHIFTTRSRTRLFGKGDSEEASPLDCPYEEGGLASCPIITVSSVLTIQRPGDGPASVRPSSQDSVSAGEKPPRLYDRRSIFDAVAQSNCQELESLLPFLQRSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLLDVARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMTLVTLLVENGADVQAAANGDFFKKTKGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTVDNTKFVTSMYNEILILGAKLHPTLKLEEITNRKGLTPLALAASSGKIGVLAYILQREIHEPECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDKWDRFVKRIFYFNFFVYCLYMIIFTAAAYYRPVEGLPPYKLKNTVGDYFRVTGEILSVSGGVYFFFRGIQYFLQRRPSLKSLFVDSYSEILFFVQSLFMLVSVVLYFSQRKEYVASMVFSLAMGWTNMLYYTRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLIEDGKNNSLPMESTPHKCRGSACKPGNSYNSLYSTCLELFKFTIGMGDLEFTENYDFKAVFIILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILDTEKSFLKCMRKAFRSGKLLQVGFTPDGKDDYRWCFRVDEVNWTTWNTNVGIINEDPGNCEGVKRTLSFSLRSGRVSGRNWKNFALVPLLRDASTRDRHATQQEEVQLKHYTGSLKPEDAEVFKDSMVPGEK dktx_hapsc-trpv1-1 3292031 N/A 3292035 unspecified role unspecified role unspecified role unspecified role ecolx Escherichia coli N/A 3292036 unspecified role unspecified role unspecified role unspecified role Region 110-603/627-764 Region 110-603/627-764 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false trpv1-12 3292032 N/A 3292036 unspecified role unspecified role unspecified role unspecified role Region 110-603/627-764 Region 110-603/627-764 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false trpv1-13 3292033 N/A 3292036 unspecified role unspecified role unspecified role unspecified role Region 110-603/627-764 Region 110-603/627-764 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false trpv1-14 3292034 N/A 3292036 unspecified role unspecified role unspecified role unspecified role Region 110-603/627-764 Region 110-603/627-764 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false human Homo sapiens Human direct interaction direct interaction false false false