DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ li-2016-50 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268561X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-51 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268551X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-52 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268571X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-53 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268565X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-54 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268557X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-55 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268552X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-56 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268567X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-57 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268562X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-58 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268570X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-59 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268553X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-60 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268566X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-61 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268558X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-62 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268563X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-63 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268554X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-64 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268568X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-65 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268559X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-66 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268555X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-67 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268564X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-68 nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268569X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-69 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268556X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation li-2016-70 nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc predetermined predetermined participant predetermined Li Z., Waadt R., Schroeder JI. DIP original experiment: DIP-268560X PLoS biology 2016 IMEx Release of GTP Exchange Factor Mediated Down-Regulation of Abscisic Acid Signal Transduction through ABA-Induced Rapid Degradation of RopGEFs. Li Z., Waadt R., Schroeder JI. Only protein-protein interactions imex curation p2c16_arath Protein phosphatase 2C 16 HAB1 P2C-HA Protein phosphatase 2C HAB1 AtP2C-HA Protein HYPERSENSITIVE TO ABA 1 F28P22.4 At1g72770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEMTPAVAMTLSLAANTMCESSPVEITQLKNVTDAADLLSDSENQSFCNGGTECTMEDVSELEEVGEQDLLKTLSDTRSGSSNVFDEDDVLSVVEDNSAVISEGLLVVDAGSELSLSNTAMEIDNGRVLATAIIVGESSIEQVPTAEVLIAGVNQDTNTSEVVIRLPDENSNHLVKGRSVYELDCIPLWGTVSIQGNRSEMEDAFAVSPHFLKLPIKMLMGDHEGMSPSLTHLTGHFFGVYDGHGGHKVADYCRDRLHFALAEEIERIKDELCKRNTGEGRQVQWDKVFTSCFLTVDGEIEGKIGRAVVGSSDKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDLKAQRKFKTRT rogf1_arath Rop guanine nucleotide exchange factor 1 ROPGEF1 Rho of plants guanine nucleotide exchange factor 1 Kinase partner protein-like F22I13.200 At4g38430 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSLSSEEDDEVSSERCGSYSPSADISESESSSSFSCHRFDGEGASSSIPSSPRVVAGRGFYFPAPVMLPVIGGKDVVWDDKQPDNDLSEIEMMKERFAKLLLGEDMSGGGKGVCTALAISNAITNLSATVFGELWRLEPLAPQKKAMWRRELEWLLCVSDSIVELIPSIQQFPGGGTYEIMETRPRSDLYANLPALKKLDAMLIDMLDAFSDTEFWYTDRGIVLGDCDKDSYNSPASVRQEDKWWLPCPKVPPNGLSEEARKKLQQCRDFANQILKAALAINSGVLAEMEIPDPYLETLPKSGKECLGEIIYQYLTANKFSPECLLDCLDLSSEHQTLEIANRIEAAVHVWRQKNGRRHKKQAKLKLSSWGGKVKGLVNDNERNDFLVQRAETLLQSLRIRFPGLPQTTLDMNKIQYNKDVGQSILESYSRVMESMAFNITARIDDVLYVDDAMRRSISVTESLSLFSINGLNPQKAFSVQSSPHGSPFATPALSVASRSPRRAPPLYSVKRNGTREKGIVGETEKAWSYAGNLSSRRVTGVTPERD p2c56_arath Protein phosphatase 2C 56 Protein ABSCISIC ACID-INSENSITIVE 1 ABI1 At4g26080 F20B18.190 Protein phosphatase 2C ABI1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEVSPAIAGPFRPFSETQMDFTGIRLGKGYCNNQYSNQDSENGDLMVSLPETSSCSVSGSHGSESRKVLISRINSPNLNMKESAAADIVVVDISAGDEINGSDITSEKKMISRTESRSLFEFKSVPLYGFTSICGRRPEMEDAVSTIPRFLQSSSGSMLDGRFDPQSAAHFFGVYDGHGGSQVANYCRERMHLALAEEIAKEKPMLCDGDTWLEKWKKALFNSFLRVDSEIESVAPETVGSTSVVAVVFPSHIFVANCGDSRAVLCRGKTALPLSVDHKPDREDEAARIEAAGGKVIQWNGARVFGVLAMSRSIGDRYLKPSIIPDPEVTAVKRVKEDDCLILASDGVWDVMTDEEACEMARKRILLWHKKNAVAGDASLLADERRKEGKDPAAMSAAEYLSKLAIQRGSKDNISVVVVDLKPRRKLKSKPLN p2c75_arath Probable protein phosphatase 2C 75 AHG1 Protein phosphatase 2C AHG1 Protein ABA-HYPERSENSITIVE GERMINATION 1 MIO24.11 At5g51760 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTEIYRTISTGRGDDVSPTKCRERRRRRIEMRRQAAVFGEPSSSRNRDRTDMEVYSSFDVPLRKQARRSEIGGLPADIGGFLAPPAASSCQKSEAPVWKGEETEDEPLYGIVSVMGRSRKMEDSVTVKPNLCKPEVNRQRPVHFFAVYDGHGGSQVSTLCSTTMHTFVKEELEQNLEEEEEGSENDVVERKWRGVMKRSFKRMDEMATSTCVCGTSVPLCNCDPREAAISGSTAVTAVLTHDHIIVANTGDSRAVLCRNGMAIPLSNDHKPDRPDERARIEAAGGRVLVVDGARVEGILATSRAIGDRYLKPMVAWEPEVTFMRRESGDECLVLASDGLWDVLSSQLACDIARFCLREETPSSLDLNRMAQEDDNDGEQNPSRSVLAATLLTRLALGRQSSDNISVVVIDLKNSSQ p2c78_arath Probable protein phosphatase 2C 78 SAG113 HAI1 Protein HIGHLY ABA-INDUCED 1 Protein SENESCENCE-ASSOCIATED GENE 113 MNC17.110 At5g59220 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEICYENETMMIETTATVVKKATTTTRRRERSSSQAARRRRMEIRRFKFVSGEQEPVFVDGDLQRRRRRESTVAASTSTVFYETAKEVVVLCESLSSTVVALPDPEAYPKYGVASVCGRRREMEDAVAVHPFFSRHQTEYSSTGFHYCGVYDGHGCSHVAMKCRERLHELVREEFEADADWEKSMARSFTRMDMEVVALNADGAAKCRCELQRPDCDAVGSTAVVSVLTPEKIIVANCGDSRAVLCRNGKAIALSSDHKPDRPDELDRIQAAGGRVIYWDGPRVLGVLAMSRAIGDNYLKPYVISRPEVTVTDRANGDDFLILASDGLWDVVSNETACSVVRMCLRGKVNGQVSSSPEREMTGVGAGNVVVGGGDLPDKACEEASLLLTRLALARQSSDNVSVVVVDLRRDT o04719-1 Protein phosphatase 2C 77 PP2C77 ABI2 Protein ABSCISIC ACID-INSENSITIVE 2 Protein phosphatase 2C ABI2 MHM17.19 At5g57050 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDEVSPAVAVPFRPFTDPHAGLRGYCNGESRVTLPESSCSGDGAMKDSSFEINTRQDSLTSSSSAMAGVDISAGDEINGSDEFDPRSMNQSEKKVLSRTESRSLFEFKCVPLYGVTSICGRRPEMEDSVSTIPRFLQVSSSSLLDGRVTNGFNPHLSAHFFGVYDGHGGSQVANYCRERMHLALTEEIVKEKPEFCDGDTWQEKWKKALFNSFMRVDSEIETVAHAPETVGSTSVVAVVFPTHIFVANCGDSRAVLCRGKTPLALSVDHKPDRDDEAARIEAAGGKVIRWNGARVFGVLAMSRSIGDRYLKPSVIPDPEVTSVRRVKEDDCLILASDGLWDVMTNEEVCDLARKRILLWHKKNAMAGEALLPAEKRGEGKDPAAMSAAEYLSKMALQKGSKDNISVVVVDLKGIRKFKSKSLN p2c24_arath Probable protein phosphatase 2C 24 F16P2.24 At2g29380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAEICYEVVTDACPSSVYESTPAHSRRRPRFQTVMHEDWEKNCKRSKQEALATRYSSIPRSSREDFSDQNVDVSSPRYGVSSVCGRRREMEDAVAIHPSFSSPKNSEFPQHYFGVYDGHGCSHVAARCRERLHKLVQEELSSDMEDEEEWKTTMERSFTRMDKEVVSWGDSVVTANCKCDLQTPACDSVGSTAVVSVITPDKIVVANCGDSRAVLCRNGKPVPLSTDHKPDRPDELDRIEGAGGRVIYWDCPRVLGVLAMSRAIGDNYLKPYVSCEPEVTITDRRDDDCLILASDGLWDVVSNETACSVARMCLRGGGRRQDNEDPAISDKACTEASVLLTKLALARNSSDNVSVVVIDLRR p2c37_arath Protein phosphatase 2C 37 F24K9.8 At3g11410 PP2CA AHG3 Protein ABA-HYPERSENSITIVE GERMINATION 3 Protein phosphatase 2C A protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGICCGVVGETEPAAPVDSTSRASLRRRLDLLPSIKIVADSAVAPPLENCRKRQKRETVVLSTLPGNLDLDSNVRSENKKARSAVTNSNSVTEAESFFSDVPKIGTTSVCGRRRDMEDAVSIHPSFLQRNSENHHFYGVFDGHGCSHVAEKCRERLHDIVKKEVEVMASDEWTETMVKSFQKMDKEVSQRECNLVVNGATRSMKNSCRCELQSPQCDAVGSTAVVSVVTPEKIIVSNCGDSRAVLCRNGVAIPLSVDHKPDRPDELIRIQQAGGRVIYWDGARVLGVLAMSRAIGDNYLKPYVIPDPEVTVTDRTDEDECLILASDGLWDVVPNETACGVARMCLRGAGAGDDSDAAHNACSDAALLLTKLALARQSSDNVSVVVVDLRKRRNNQASS p2c03_arath Protein phosphatase 2C 3 AIP1 Protein AKT1-INTERACTING 1 F22G5.22 At1g07430 Protein phosphatase 2C AIP1 HAI2 HON Protein HIGHLY ABA-INDUCED PP2C 2 Protein HONSU protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADICYEDETSACESRPLWSSRKWRIGVQRFRMSPSEMNPTASTTEEEDKSEGIYNKRNKQEEYDFMNCASSSPSQSSPEEESVSLEDSDVSISDGNSSVNDVAVIPSKKTVKETDLRPRYGVASVCGRRRDMEDAVALHPSFVRKQTEFSRTRWHYFGVYDGHGCSHVAARCKERLHELVQEEALSDKKEEWKKMMERSFTRMDKEVVRWGETVMSANCRCELQTPDCDAVGSTAVVSVITPEKIIVANCGDSRAVLCRNGKAVPLSTDHKPDRPDELDRIQEAGGRVIYWDGARVLGVLAMSRAIGDNYLKPYVTSEPEVTVTDRTEEDEFLILATDGLWDVVTNEAACTMVRMCLNRKSGRGRRRGETQTPGRRSEEEGKEEEEKVVGSRKNGKRGEITDKACTEASVLLTKLALAKHSSDNVSVVVIDLRRRRKRHVA rogfb_arath Rop guanine nucleotide exchange factor 11 ROPGEF11 PIRF1 Phytochrome interacting RopGEF 1 Rho of plants guanine nucleotide exchange factor 11 F9I5.12 At1g52240 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVKAMEQEQETYKSRLFHFKNMNENSASRHVKSWSSDCAMRMDGSDNLDDDDNDMMMFRSQPGKCGSVDRPSLPIGGVTPNRNDKLPRVSSSDSMEALIILQAAMEQMKEKFSKLLLGEDMSGGGKGVSSALALSNAITNLAASAFGEQRRLEPMAVDRKTRWRREIGWLISVADYIVEFAPTQQTNKDGTSMEVMSTRQRTDLLCNIPALKKLDAMLLDCLDKFKDQDEFYYVKKDSPDSCETRNDEKWWLPAVKVPPNGLSEISRRFLQSQKECVNQVLKAAMAINAQVLSEMEIPESYLESLPKNGRASLGDVIYRMITVEMFDADQFLIEMDLSSEHKILDLKNRIEASIVIWKRKMVQKDTKSPWGSTVSIEKREQFEERAETILLLLKQGFPGISQSSLDISKIQFNRDVGLAILESYSRVLESLAHTVMSRIEDVLYADQLTQEPTNNAPSKNRYSLKENEKLREERLSFTEDMASGTLSDVMQWGNKNNEMKKESFFGDREKPLLSKVTGIMTNNKKSSYLDNLGAMRSPTARYS pyl9_arath Abscisic acid receptor PYL9 At1g01360 PYL9 RCAR1 PYR1-like protein 9 ABI1-binding protein 4 Regulatory components of ABA receptor 1 F6F3.16 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMDGVEGGTAMYGGLETVQYVRTHHQHLCRENQCTSALVKHIKAPLHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIGSLREVNVKSGLPATTSTERLELLDDEEHILGIKIIGGDHRLKNYSSILTVHPEIIEGRAGTMVIESFVVDVPQGNTKDETCYFVEALIRCNLKSLADVSERLASQDITQ p2c07_arath Protein phosphatase 2C 7 HAB2 Protein HYPERSENSITIVE TO ABA 2 Protein phosphatase 2C HAB2 F1L3.32 At1g17550 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEISPAVALTLGLANTMCDSGISSTFDISELENVTDAADMLCNQKRQRYSNGVVDCIMGSVSEEKTLSEVRSLSSDFSVTVQESEEDEPLVSDATIISEGLIVVDARSEISLPDTVETDNGRVLATAIILNETTIEQVPTAEVLIASLNHDVNMEVATSEVVIRLPEENPNVARGSRSVYELECIPLWGTISICGGRSEMEDAVRALPHFLKIPIKMLMGDHEGMSPSLPYLTSHFFGVYDGHGGAQVADYCHDRIHSALAEEIERIKEELCRRNTGEGRQVQWEKVFVDCYLKVDDEVKGKINRPVVGSSDRMVLEAVSPETVGSTAVVALVCSSHIIVSNCGDSRAVLLRGKDSMPLSVDHKPDREDEYARIEKAGGKVIQWQGARVSGVLAMSRSIGDQYLEPFVIPDPEVTFMPRAREDECLILASDGLWDVMSNQEACDFARRRILAWHKKNGALPLAERGVGEDQACQAAAEYLSKLAIQMGSKDNISIIVIDLKAQRKFKTRS hab1-ropgef1-1 3291673 N/A 3291694 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3291695 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false ropgef1-abi1-1 3291674 N/A 3291696 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3291695 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ropgef1-ahg1-1 3291675 N/A 3291697 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3291695 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false ropgef1-sag113-1 3291676 N/A 3291698 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3291695 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ropgef1-abi1-2 3291677 N/A 3291696 unspecified role unspecified role prey prey StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3291695 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ropgef1-abi2-1 3291678 N/A 3291699 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3291695 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ropgef1-p2c24_arath-1 3291679 N/A 3291700 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3291695 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false pp2ca-ropgef1-1 3291680 N/A 3291701 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3291695 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false ropgef1-sag113-2 3291681 N/A 3291698 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3291695 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false ropgef1-hab1-1 3291682 N/A 3291694 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3291695 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ropgef1-aip1-1 3291683 N/A 3291702 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3291695 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ropgef1-ropgef11-1 3291684 N/A 3291703 unspecified role unspecified role prey prey StrepII-tag StrepII-tag strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli N/A 3291695 unspecified role unspecified role bait bait GST-tag GST-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecolx Escherichia coli direct interaction direct interaction false false false ropgef1-ropgef11-2 3291685 N/A 3291703 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3291695 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false ropgef1-pp2ca-1 3291686 N/A 3291701 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3291695 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ropgef1-ahg1-2 3291687 N/A 3291697 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3291695 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false abi1-ropgef1-1 3291688 N/A 3291696 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3291695 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false pyl9-abi1-1 3291689 N/A 3291704 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3291696 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ropgef1-hab2-1 3291690 N/A 3291705 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3291695 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false ropgef1-abi1-3 3291691 N/A 3291696 unspecified role unspecified role prey prey Myc-tag Myc-tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3291695 unspecified role unspecified role bait bait Flag-tag Flag-tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false ropgef1-ropgef11-3 3291692 N/A 3291703 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 3291695 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false abi2-ropgef1-1 3291693 N/A 3291699 unspecified role unspecified role unspecified role unspecified role nYFP-tag nYFP-tag nyfp nYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana N/A 3291695 unspecified role unspecified role unspecified role unspecified role cYFP-tag cYFP-tag cyfp cYFP n-term range n-terminal range n-term range n-term range n-terminal range n-term range false nicbe Nicotiana benthamiana physical association physical association false false false